Recombinant Human APOA2 protein, GST-tagged
| Cat.No. : | APOA2-691H |
| Product Overview : | Human APOA2 full-length ORF ( AAH05282, 1 a.a. - 100 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | This gene encodes apolipoprotein (apo-) A-II, which is the second most abundant protein of the high density lipoprotein particles. The protein is found in plasma as a monomer, homodimer, or heterodimer with apolipoprotein D. Defects in this gene may result in apolipoprotein A-II deficiency or hypercholesterolemia. [provided by RefSeq, Jul 2008] |
| Molecular Mass : | 36.74 kDa |
| AA Sequence : | MKLLAATVLLLTICSLEGALVRRQAKEPCVESLVSQYFQTVTDYGKDLMEKVKSPELQAEAKSYFEKSKEQLTPLIKKAGTELVNFLSYFVELGTQPATQ |
| Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | APOA2 apolipoprotein A-II [ Homo sapiens ] |
| Official Symbol | APOA2 |
| Synonyms | APOA2; apolipoprotein A-II; apolipoprotein A2; apoAII; Apo-AII; ApoA-II; |
| Gene ID | 336 |
| mRNA Refseq | NM_001643 |
| Protein Refseq | NP_001634 |
| UniProt ID | P02652 |
| ◆ Recombinant Proteins | ||
| APOA2-0302H | Recombinant Human APOA2 Protein, Tag Free | +Inquiry |
| APOA2-0300H | Recombinant Human APOA2 Protein (Gln24-Gln100), C-His-tagged | +Inquiry |
| APOA2-95H | Recombinant Human APOA2, His-tagged | +Inquiry |
| APOA2-9748H | Recombinant Human APOA2, GST-tagged | +Inquiry |
| Apoa2-3566R | Recombinant Rat Apoa2, GST-tagged | +Inquiry |
| ◆ Native Proteins | ||
| ApoC-II-3558H | Native Human ApoC-II | +Inquiry |
| APOA2-5302H | Native Human Apolipoprotein A-II | +Inquiry |
| APOA2-608H | Native Human Apolipoprotein A-II | +Inquiry |
| APOA2-8036H | Native Human ApoLipoprotein APOA2 | +Inquiry |
| ApoA-II-3555H | Native Human ApoA-II | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| APOA2-8789HCL | Recombinant Human APOA2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All APOA2 Products
Required fields are marked with *
My Review for All APOA2 Products
Required fields are marked with *



