Recombinant Human APOA2, His-tagged
Cat.No. : | APOA2-95H |
Product Overview : | Recombinant Human Apolipoprotein A-II/ApoA2 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Gln24-Gln100) of Human APOA2 fused with a polyhistidine tag at the C-terminus. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Human Cells |
Tag : | His |
Protein Length : | 24-100 a.a. |
Description : | This gene encodes apolipoprotein (apo-) A-II, which is the second most abundant protein of the high density lipoprotein particles. The protein is found in plasma as a monomer, homodimer, or heterodimer with apolipoprotein D. Defects in this gene may result in apolipoprotein A-II deficiency or hypercholesterolemia. |
AA Sequence : | QAKEPCVESLVSQYFQTVTDYGKDLMEKVKSPELQAEAKSYFEKSKEQLTPLIKKAGTELVNFLS YFVELGTQPATQVDHHHHHH |
Endotoxin : | Less than 0.1 ng/µg (1 IEU/µg). |
Purity : | Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
Storage : | Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months. |
Shipping : | The product is shipped at ambient temperature. |
Gene Name | APOA2 apolipoprotein A-II [ Homo sapiens (human) ] |
Official Symbol | APOA2 |
Synonyms | APOA2; apolipoprotein A-II; apoAII; Apo-AII; ApoA-II; apolipoprotein A-II; apolipoprotein A2; OTTHUMP00000032244; Apolipoprotein A-II; Apolipoprotein A2 |
Gene ID | 336 |
mRNA Refseq | NM_001643 |
Protein Refseq | NP_001634 |
MIM | 107670 |
UniProt ID | P02652 |
Chromosome Location | 1q23.3 |
Pathway | Chylomicron-mediated lipid transport; Fatty acid; Lipid digestion; Lipoprotein metabolism; Metabolism of lipids and lipoproteins; PPAR signaling pathway; Regulation of Lipid Metabolism by Peroxisome proliferator-activated receptor alpha (PPARalpha); |
Function | apolipoprotein receptor binding; cholesterol binding; contributes to cholesterol transporter activity; high-density lipoprotein particle receptor binding; lipase inhibitor activity; lipid binding; lipid transporter activity; phosphatidylcholine binding; phosphatidylcholine-sterol O-acyltransferase activator activity; phospholipid binding; protein binding; protein heterodimerization activity; protein homodimerization activity |
◆ Recombinant Proteins | ||
APOA2-0300H | Recombinant Human APOA2 Protein (Gln24-Gln100), C-His-tagged | +Inquiry |
APOA2-3331H | Recombinant Human APOA2 protein, His-SUMO-tagged | +Inquiry |
APOA2-691H | Recombinant Human APOA2 protein, GST-tagged | +Inquiry |
APOA2-1112HF | Recombinant Full Length Human APOA2 Protein, GST-tagged | +Inquiry |
APOA2-7070Z | Recombinant Zebrafish APOA2 | +Inquiry |
◆ Native Proteins | ||
ApoC-II-3558H | Native Human ApoC-II | +Inquiry |
APOA2-5302H | Native Human Apolipoprotein A-II | +Inquiry |
ApoA-II-3555H | Native Human ApoA-II | +Inquiry |
APOA2-4772H | Native Human Apolipoprotein AII protein | +Inquiry |
APOA2-8036H | Native Human ApoLipoprotein APOA2 | +Inquiry |
◆ Cell & Tissue Lysates | ||
APOA2-8789HCL | Recombinant Human APOA2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All APOA2 Products
Required fields are marked with *
My Review for All APOA2 Products
Required fields are marked with *