Recombinant Human APOBEC2 protein, GST-tagged
Cat.No. : | APOBEC2-9752H |
Product Overview : | Recombinant Human APOBEC2 protein(1-224 aa), fused with N-terminal GST tag, was expressed in E.coli. |
Availability | October 10, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-224 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH). |
AASequence : | MAQKEEAAVATEAASQNGEDLENLDDPEKLKELIELPPFEIVTGERLPANFFKFQFRNVEYSSGRNKTFLCYVVEAQGKGGQVQASRGYLEDEHAAAHAEEAFFNTILPAFDPALRYNVTWYVSSSPCAACADRIIKTLSKTKNLRLLILVGRLFMWEEPEIQAALKKLKEAGCKLRIMKPQDFEYVWQNFVEQEEGESKAFQPWEDIQENFLYYEEKLADILK |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
Gene Name | APOBEC2 apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 2 [ Homo sapiens ] |
Official Symbol | APOBEC2 |
Synonyms | APOBEC2; apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 2; probable C->U-editing enzyme APOBEC-2; ARCD1; ARP1; probable C-> U-editing enzyme APOBEC-2; apolipoprotein B mRNA editing enzyme, catalytic polypeptide 2; |
Gene ID | 10930 |
mRNA Refseq | NM_006789 |
Protein Refseq | NP_006780 |
MIM | 604797 |
UniProt ID | Q9Y235 |
◆ Recombinant Proteins | ||
APOBEC2-2475H | Recombinant Human APOBEC2 Protein, MYC/DDK-tagged | +Inquiry |
APOBEC2-632M | Recombinant Mouse APOBEC2 Protein, His (Fc)-Avi-tagged | +Inquiry |
APOBEC2-696H | Recombinant Human APOBEC2 protein, GST-tagged | +Inquiry |
APOBEC2-1786M | Recombinant Mouse APOBEC2 Protein | +Inquiry |
APOBEC2-1140HF | Recombinant Full Length Human APOBEC2 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
APOBEC2-93HCL | Recombinant Human APOBEC2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All APOBEC2 Products
Required fields are marked with *
My Review for All APOBEC2 Products
Required fields are marked with *