Recombinant Human APOBEC2 Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | APOBEC2-2366H |
| Product Overview : | APOBEC2 MS Standard C13 and N15-labeled recombinant protein (NP_006780) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | Probable C to U editing enzyme whose physiological substrate is not yet known. Does not display detectable apoB mRNA editing. Has a low intrinsic cytidine deaminase activity. May play a role in the epigenetic regulation of gene expression through the process of active DNA demethylation. |
| Molecular Mass : | 25.5 kDa |
| AA Sequence : | MAQKEEAAVATEAASQNGEDLENLDDPEKLKELIELPPFEIVTGERLPANFFKFQFRNVEYSSGRNKTFLCYVVEAQGKGGQVQASRGYLEDEHAAAHAEEAFFNTILPAFDPALRYNVTWYVSSSPCAACADRIIKTLSKTKNLRLLILVGRLFMWEEPEIQAALKKLKEAGCKLRIMKPQDFEYVWQNFVEQEEGESKAFQPWEDIQENFLYYEEKLADILKTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | APOBEC2 apolipoprotein B mRNA editing enzyme catalytic subunit 2 [ Homo sapiens (human) ] |
| Official Symbol | APOBEC2 |
| Synonyms | APOBEC2; apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 2; probable C->U-editing enzyme APOBEC-2; ARCD1; ARP1; probable C-> U-editing enzyme APOBEC-2; apolipoprotein B mRNA editing enzyme, catalytic polypeptide 2; |
| Gene ID | 10930 |
| mRNA Refseq | NM_006789 |
| Protein Refseq | NP_006780 |
| MIM | 604797 |
| UniProt ID | Q9Y235 |
| ◆ Recombinant Proteins | ||
| APOBEC2-1140HF | Recombinant Full Length Human APOBEC2 Protein, GST-tagged | +Inquiry |
| APOBEC2-2475H | Recombinant Human APOBEC2 Protein, MYC/DDK-tagged | +Inquiry |
| APOBEC2-696H | Recombinant Human APOBEC2 protein, GST-tagged | +Inquiry |
| APOBEC2-2366H | Recombinant Human APOBEC2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| APOBEC2-9752H | Recombinant Human APOBEC2 protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| APOBEC2-93HCL | Recombinant Human APOBEC2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All APOBEC2 Products
Required fields are marked with *
My Review for All APOBEC2 Products
Required fields are marked with *
