Recombinant Human APOBEC2 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: APOBEC2-2366H
• Product Overview: APOBEC2 MS Standard C13 and N15-labeled recombinant protein (NP_006780) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: Probable C to U editing enzyme whose physiological substrate is not yet known. Does not display detectable apoB mRNA editing. Has a low intrinsic cytidine deaminase activity. May play a role in the epigenetic regulation of gene expression through the process of active DNA demethylation.
• Molecular Mass: 25.5 kDa
• AA Sequence: MAQKEEAAVATEAASQNGEDLENLDDPEKLKELIELPPFEIVTGERLPANFFKFQFRNVEYSSGRNKTFLCYVVEAQGKGGQVQASRGYLEDEHAAAHAEEAFFNTILPAFDPALRYNVTWYVSSSPCAACADRIIKTLSKTKNLRLLILVGRLFMWEEPEIQAALKKLKEAGCKLRIMKPQDFEYVWQNFVEQEEGESKAFQPWEDIQENFLYYEEKLADILKTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: APOBEC2 apolipoprotein B mRNA editing enzyme catalytic subunit 2 [ Homo sapiens (human) ]
• Official Symbol: APOBEC2
• Synonyms: APOBEC2; apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 2; probable C->U-editing enzyme APOBEC-2; ARCD1; ARP1; probable C-> U-editing enzyme APOBEC-2; apolipoprotein B mRNA editing enzyme, catalytic polypeptide 2
• Gene ID: 10930
• mRNA Refseq: NM_006789
• Protein Refseq: NP_006780
• MIM: 604797
• UniProt ID: Q9Y235