Recombinant Human APOBEC3D protein, GST-tagged

Cat.No. : APOBEC3D-699H
Product Overview : Human APOBEC3D full-length ORF ( ENSP00000216099, 1 a.a. - 386 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene is a member of the cytidine deaminase gene family. It is one of a group of related genes found in a cluster, thought to result from gene duplication, on chromosome 22. Members of the cluster encode proteins that are structurally and functionally related to the C to U RNA-editing cytidine deaminase APOBEC1 and inhibit retroviruses, such as HIV, by deaminating cytosine residues in nascent retroviral cDNA. [provided by RefSeq, Jul 2008]
Molecular Mass : 73 kDa
AA Sequence : MNPQIRNPMERMYRDTFYDNFENEPILYGRSYTWLCYEVKIKRGRSNLLWDTGVFRGPVLPKRQSNHRQEVYFRFENHAEMCFLSWFCGNRLPANRRFQITWFVSWNPCLPCVVKVTKFLAEHPNVTLTISAARLYYYRDRDWRWVLLRLHKAGARVKIMDYEDFAYCWENFVCNEGQPFMPWYKFDDNYASLHRTLKEILRNPMEAMYPHIFYFHFKNLLKACGRNESWLCFTMEVTKHHSAVFRKRGVFRNQVDPETHCHAERCFLSWFCDDILSPNTNYEVTWYTSWSPCPECAGEVAEFLARHSNVNLTIFTARLCYFWDTDYQEGLCSLSQEGASVKIMGYKDFVSCWKNFVYSDDEPFKPWKGLQTNFRLLKRRLREILQ
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name APOBEC3D apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 3D [ Homo sapiens ]
Official Symbol APOBEC3D
Synonyms APOBEC3D; apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 3D; APOBEC3E, apolipoprotein B mRNA editing enzyme, catalytic polypeptide like 3D (putative) , apolipoprotein B mRNA editing enzyme, catalytic polypeptide like 3E pseudogene; probable DNA dC->dU-editing enzyme APOBEC-3D; ARP6; probable DNA dC-> dU-editing enzyme APOBEC-3D; DNA dC-> apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 3E pseudogene; APOBEC3E; APOBEC3DE;
Gene ID 140564
mRNA Refseq NM_152426
Protein Refseq NP_689639
MIM 609900
UniProt ID Q96AK3

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All APOBEC3D Products

Required fields are marked with *

My Review for All APOBEC3D Products

Required fields are marked with *

0

Inquiry Basket

cartIcon