Recombinant Human APOBEC3D protein, GST-tagged
Cat.No. : | APOBEC3D-699H |
Product Overview : | Human APOBEC3D full-length ORF ( ENSP00000216099, 1 a.a. - 386 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene is a member of the cytidine deaminase gene family. It is one of a group of related genes found in a cluster, thought to result from gene duplication, on chromosome 22. Members of the cluster encode proteins that are structurally and functionally related to the C to U RNA-editing cytidine deaminase APOBEC1 and inhibit retroviruses, such as HIV, by deaminating cytosine residues in nascent retroviral cDNA. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 73 kDa |
AA Sequence : | MNPQIRNPMERMYRDTFYDNFENEPILYGRSYTWLCYEVKIKRGRSNLLWDTGVFRGPVLPKRQSNHRQEVYFRFENHAEMCFLSWFCGNRLPANRRFQITWFVSWNPCLPCVVKVTKFLAEHPNVTLTISAARLYYYRDRDWRWVLLRLHKAGARVKIMDYEDFAYCWENFVCNEGQPFMPWYKFDDNYASLHRTLKEILRNPMEAMYPHIFYFHFKNLLKACGRNESWLCFTMEVTKHHSAVFRKRGVFRNQVDPETHCHAERCFLSWFCDDILSPNTNYEVTWYTSWSPCPECAGEVAEFLARHSNVNLTIFTARLCYFWDTDYQEGLCSLSQEGASVKIMGYKDFVSCWKNFVYSDDEPFKPWKGLQTNFRLLKRRLREILQ |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | APOBEC3D apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 3D [ Homo sapiens ] |
Official Symbol | APOBEC3D |
Synonyms | APOBEC3D; apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 3D; APOBEC3E, apolipoprotein B mRNA editing enzyme, catalytic polypeptide like 3D (putative) , apolipoprotein B mRNA editing enzyme, catalytic polypeptide like 3E pseudogene; probable DNA dC->dU-editing enzyme APOBEC-3D; ARP6; probable DNA dC-> dU-editing enzyme APOBEC-3D; DNA dC-> apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 3E pseudogene; APOBEC3E; APOBEC3DE; |
Gene ID | 140564 |
mRNA Refseq | NM_152426 |
Protein Refseq | NP_689639 |
MIM | 609900 |
UniProt ID | Q96AK3 |
◆ Recombinant Proteins | ||
APOBEC3D-9756H | Recombinant Human APOBEC3D, His-tagged | +Inquiry |
APOBEC3D-699H | Recombinant Human APOBEC3D protein, GST-tagged | +Inquiry |
APOBEC3D-1371HF | Recombinant Full Length Human APOBEC3D Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All APOBEC3D Products
Required fields are marked with *
My Review for All APOBEC3D Products
Required fields are marked with *