Recombinant Human APOBEC3H protein, GST-tagged

• Cat.No.: APOBEC3H-702H
• Product Overview: Human APOBEC3H full-length ORF ( AAH69023.1, 1 a.a. - 182 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene encodes a member of the apolipoprotein B mRNA-editing enzyme catalytic polypeptide 3 family of proteins. The encoded protein is a cytidine deaminase that has antiretroviral activity by generating lethal hypermutations in viral genomes. Polymorphisms and alternative splicing in this gene influence its antiretroviral activity and are associated with increased resistence to human immunodeficiency virus type 1 infection in certain populations. Alternative splicing results in multiple transcript variants.[provided by RefSeq, Oct 2009]
• Molecular Mass: 47.9 kDa
• AA Sequence: MALLTAETFRLQFNNKRRLRRPYYPRKALLCYQLTPQNGSTPTRGYFENKKKCHAEICFINEIKSMGLDETQCYQVTCYLTWSPCSSCAWELVDFIKAHDHLNLGIFASRLYYHWCKPQQKGLRLLCGSQVPVEVMGFPEFADCWENFVDHEKPLSFNPYKMLEELDKNSRAIKRRLERIKS
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: APOBEC3H apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 3H [ Homo sapiens ]
• Official Symbol: APOBEC3H
• Synonyms: APOBEC3H; apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 3H; DNA dC->dU-editing enzyme APOBEC-3H; ARP10; DNA dC-> dU-editing enzyme APOBEC-3H; ARP-10; APOBEC-related protein 10; apolipoprotein B mRNA-editing enzyme catalytic polypeptide-like 3H
• Gene ID: 164668
• mRNA Refseq: NM_001166002
• Protein Refseq: NP_001159474
• MIM: 610976
• UniProt ID: Q6NTF7