Recombinant Human APOBEC3H protein, GST-tagged

Cat.No. : APOBEC3H-702H
Product Overview : Human APOBEC3H full-length ORF ( AAH69023.1, 1 a.a. - 182 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a member of the apolipoprotein B mRNA-editing enzyme catalytic polypeptide 3 family of proteins. The encoded protein is a cytidine deaminase that has antiretroviral activity by generating lethal hypermutations in viral genomes. Polymorphisms and alternative splicing in this gene influence its antiretroviral activity and are associated with increased resistence to human immunodeficiency virus type 1 infection in certain populations. Alternative splicing results in multiple transcript variants.[provided by RefSeq, Oct 2009]
Molecular Mass : 47.9 kDa
AA Sequence : MALLTAETFRLQFNNKRRLRRPYYPRKALLCYQLTPQNGSTPTRGYFENKKKCHAEICFINEIKSMGLDETQCYQVTCYLTWSPCSSCAWELVDFIKAHDHLNLGIFASRLYYHWCKPQQKGLRLLCGSQVPVEVMGFPEFADCWENFVDHEKPLSFNPYKMLEELDKNSRAIKRRLERIKS
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name APOBEC3H apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 3H [ Homo sapiens ]
Official Symbol APOBEC3H
Synonyms APOBEC3H; apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 3H; DNA dC->dU-editing enzyme APOBEC-3H; ARP10; DNA dC-> dU-editing enzyme APOBEC-3H; ARP-10; APOBEC-related protein 10; apolipoprotein B mRNA-editing enzyme catalytic polypeptide-like 3H;
Gene ID 164668
mRNA Refseq NM_001166002
Protein Refseq NP_001159474
MIM 610976
UniProt ID Q6NTF7

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All APOBEC3H Products

Required fields are marked with *

My Review for All APOBEC3H Products

Required fields are marked with *

0

Inquiry Basket

cartIcon