Recombinant Human APOBEC3H protein, GST-tagged
Cat.No. : | APOBEC3H-702H |
Product Overview : | Human APOBEC3H full-length ORF ( AAH69023.1, 1 a.a. - 182 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a member of the apolipoprotein B mRNA-editing enzyme catalytic polypeptide 3 family of proteins. The encoded protein is a cytidine deaminase that has antiretroviral activity by generating lethal hypermutations in viral genomes. Polymorphisms and alternative splicing in this gene influence its antiretroviral activity and are associated with increased resistence to human immunodeficiency virus type 1 infection in certain populations. Alternative splicing results in multiple transcript variants.[provided by RefSeq, Oct 2009] |
Molecular Mass : | 47.9 kDa |
AA Sequence : | MALLTAETFRLQFNNKRRLRRPYYPRKALLCYQLTPQNGSTPTRGYFENKKKCHAEICFINEIKSMGLDETQCYQVTCYLTWSPCSSCAWELVDFIKAHDHLNLGIFASRLYYHWCKPQQKGLRLLCGSQVPVEVMGFPEFADCWENFVDHEKPLSFNPYKMLEELDKNSRAIKRRLERIKS |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | APOBEC3H apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 3H [ Homo sapiens ] |
Official Symbol | APOBEC3H |
Synonyms | APOBEC3H; apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 3H; DNA dC->dU-editing enzyme APOBEC-3H; ARP10; DNA dC-> dU-editing enzyme APOBEC-3H; ARP-10; APOBEC-related protein 10; apolipoprotein B mRNA-editing enzyme catalytic polypeptide-like 3H; |
Gene ID | 164668 |
mRNA Refseq | NM_001166002 |
Protein Refseq | NP_001159474 |
MIM | 610976 |
UniProt ID | Q6NTF7 |
◆ Recombinant Proteins | ||
APOBEC3H-9758H | Recombinant Human APOBEC3H, His-tagged | +Inquiry |
APOBEC3H-1397HF | Recombinant Full Length Human APOBEC3H Protein, GST-tagged | +Inquiry |
APOBEC3H-366R | Recombinant Rhesus monkey APOBEC3H Protein, His-tagged | +Inquiry |
APOBEC3H-702H | Recombinant Human APOBEC3H protein, GST-tagged | +Inquiry |
APOBEC3H-195R | Recombinant Rhesus Macaque APOBEC3H Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
APOBEC3H-96HCL | Recombinant Human APOBEC3H cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All APOBEC3H Products
Required fields are marked with *
My Review for All APOBEC3H Products
Required fields are marked with *
0
Inquiry Basket