Recombinant Human APOC1 protein, N/A-tagged
| Cat.No. : | APOC1-2537H |
| Product Overview : | Recombinant Human APOC1 protein(P02654)(27-83aa) was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | Non |
| Protein Length : | 27-83aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 6.6 kDa |
| AA Sequence : | TPDVSSALDKLKEFGNTLEDKARELISRIKQSELSAKMREWFSETFQKVKEKLKIDS |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | APOC1 apolipoprotein C-I [ Homo sapiens ] |
| Official Symbol | APOC1 |
| Synonyms | APOC1; apolipoprotein C-I; apo-CIB; apoC-IB; apolipoprotein C1; |
| Gene ID | 341 |
| mRNA Refseq | NM_001645 |
| Protein Refseq | NP_001636 |
| MIM | 107710 |
| UniProt ID | P02654 |
| ◆ Recombinant Proteins | ||
| APOC1-4903H | Recombinant Human Apolipoprotein C-I | +Inquiry |
| APOC1-301D | Recombinant Dog APOC1 Protein, His/GST-tagged | +Inquiry |
| APOC1-704H | Recombinant Human APOC1 protein, GST-tagged | +Inquiry |
| APOC1-379R | Recombinant Rat APOC1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| APOC1-1787M | Recombinant Mouse APOC1 Protein | +Inquiry |
| ◆ Native Proteins | ||
| APOC1-27328TH | Native Human APOC1 protein | +Inquiry |
| APOC1-27330TH | Native Human APOC1 | +Inquiry |
| APOC1-8038H | Native Human ApoLipoprotein CI | +Inquiry |
| APOC1-616H | Native Human Apolipoprotein C-I | +Inquiry |
| ApoC-I-3557H | Native Human ApoC-I | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| APOC1-97HCL | Recombinant Human APOC1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All APOC1 Products
Required fields are marked with *
My Review for All APOC1 Products
Required fields are marked with *
