Recombinant Human APOC1 protein, N/A-tagged
Cat.No. : | APOC1-2537H |
Product Overview : | Recombinant Human APOC1 protein(P02654)(27-83aa) was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | Non |
Protein Length : | 27-83aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 6.6 kDa |
AA Sequence : | TPDVSSALDKLKEFGNTLEDKARELISRIKQSELSAKMREWFSETFQKVKEKLKIDS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | APOC1 apolipoprotein C-I [ Homo sapiens ] |
Official Symbol | APOC1 |
Synonyms | APOC1; apolipoprotein C-I; apo-CIB; apoC-IB; apolipoprotein C1; |
Gene ID | 341 |
mRNA Refseq | NM_001645 |
Protein Refseq | NP_001636 |
MIM | 107710 |
UniProt ID | P02654 |
◆ Recombinant Proteins | ||
Apoc1-303M | Recombinant Mouse Apoc1 protein, His-GST-tagged | +Inquiry |
APOC1-5058H | Recombinant Human APOC1, His-tagged | +Inquiry |
APOC1-220H | Recombinant Human APOC1 Protein, His&GST-tagged | +Inquiry |
Apoc1-304R | Recombinant Rat Apoc1 Protein, His/GST-tagged | +Inquiry |
APOC1-311H | Recombinant Human APOC1 protein, GST-tagged | +Inquiry |
◆ Native Proteins | ||
APOC1-27328TH | Native Human APOC1 protein | +Inquiry |
APOC1-27330TH | Native Human APOC1 | +Inquiry |
ApoC-I-3557H | Native Human ApoC-I | +Inquiry |
APOC1-616H | Native Human Apolipoprotein C-I | +Inquiry |
APOC1-8038H | Native Human ApoLipoprotein CI | +Inquiry |
◆ Cell & Tissue Lysates | ||
APOC1-97HCL | Recombinant Human APOC1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All APOC1 Products
Required fields are marked with *
My Review for All APOC1 Products
Required fields are marked with *