Recombinant Human APOC3 protein

• Cat.No.: APOC3-362H
• Product Overview: Recombinant Human APOC3 protein without tag was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: Non
• Protein Length: 21-99 aa
• Storage: Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Molecular Mass: 9 kDa
• AA Sequence: SEAEDASLLSFMQGYMKHATKTAKDALSSVQESQVAQQARGWVTDGFSSLKDYWSTVKDKFSEFWDLDPEVRPTSAVAA
• Endotoxin: <1 EU/μg by LAL.
• Purity: >90% by SDS-PAGE
• Concentration: 0.84 mg/mL by BCA

Gene Information

• Official Symbol: APOC3
• Synonyms: APOC3; apolipoprotein C3; Apo-C3; ApoC-3; APOCIII; apolipoprotein C-III
• mRNA Refseq: NM_000040
• Protein Refseq: NP_000031
• MIM: 107720
• UniProt ID: P02656
• Gene ID: 345