Recombinant Human APOC3 protein
| Cat.No. : | APOC3-362H |
| Product Overview : | Recombinant Human APOC3 protein without tag was expressed in E. coli. |
| Availability | December 30, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | Non |
| Protein Length : | 21-99 aa |
| Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
| Molecular Mass : | 9 kDa |
| AA Sequence : | SEAEDASLLSFMQGYMKHATKTAKDALSSVQESQVAQQARGWVTDGFSSLKDYWSTVKDKFSEFWDLDPEVRPTSAVAA |
| Endotoxin : | <1 EU/μg by LAL. |
| Purity : | >90% by SDS-PAGE |
| Concentration : | 0.84 mg/mL by BCA |
| Official Symbol | APOC3 |
| Synonyms | APOC3; apolipoprotein C3; Apo-C3; ApoC-3; APOCIII; apolipoprotein C-III |
| mRNA Refseq | NM_000040 |
| Protein Refseq | NP_000031 |
| MIM | 107720 |
| UniProt ID | P02656 |
| Gene ID | 345 |
| ◆ Recombinant Proteins | ||
| APOC3-362H | Recombinant Human APOC3 protein | +Inquiry |
| APOC3-635M | Recombinant Mouse APOC3 Protein, His (Fc)-Avi-tagged | +Inquiry |
| Apoc3-818M | Recombinant Mouse Apoc3 Protein, MYC/DDK-tagged | +Inquiry |
| APOC3-1128HF | Recombinant Full Length Human APOC3 Protein, GST-tagged | +Inquiry |
| APOC3-2539H | Recombinant Human APOC3 protein, His-SUMO-tagged | +Inquiry |
| ◆ Native Proteins | ||
| APOC3-361H | Native Human Apolipoprotein C-III | +Inquiry |
| APOC3-669H | Native Human APOC3 protein | +Inquiry |
| ApoC-III-3559H | Native Human ApoC-III | +Inquiry |
| APOC3-8040H | Native Human ApoLipoprotein CIII | +Inquiry |
| APOC3-27333TH | Native Human APOC3 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| APOC3-8782HCL | Recombinant Human APOC3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All APOC3 Products
Required fields are marked with *
My Review for All APOC3 Products
Required fields are marked with *
