Recombinant Human ApoE2 Protein

Cat.No. : APOE-03H
Product Overview : Recombinant Human ApoE2 Protein (1-162) without tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Protein Length : 1-162
Description : The protein encoded by this gene is a major apoprotein of the chylomicron. It binds to a specific liver and peripheral cell receptor, and is essential for the normal catabolism of triglyceride-rich lipoprotein constituents. This gene maps to chromosome 19 in a cluster with the related apolipoprotein C1 and C2 genes. Mutations in this gene result in familial dysbetalipoproteinemia, or type III hyperlipoproteinemia (HLP III), in which increased plasma cholesterol and triglycerides are the consequence of impaired clearance of chylomicron and VLDL remnants.
Form : Lyophilized
Molecular Mass : 19093.70 Da
AA Sequence : MKVEQAVETEPEPELRQQTEWQSGQRWELALGRFWDYLRWVQTLSEQVQEELLSSQVTQELRALMDETMKELKAYKSELEEQLTPVAEETRARLSKELQAAQARLGADMEDVCGRLVQYRGEVQAMLGQSTEELRVRLASHLRKLRKRLLRDADDLQKCLAVY
Purity : 95% by Chromatography and SDS-PAGE
Storage : Store at -20 centigrade upon arrival.
Dilutions : ApoE is soluble in PBS.
Gene Name APOE apolipoprotein E [ Homo sapiens (human) ]
Official Symbol APOE
Synonyms APOE; apolipoprotein E; AD2; LPG; APO-E; ApoE4; LDLCQ5; apolipoprotein E; apolipoprotein E3
Gene ID 348
mRNA Refseq NM_000041
Protein Refseq NP_000032
MIM 107741
UniProt ID P02649

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ApoE2 Products

Required fields are marked with *

My Review for All ApoE2 Products

Required fields are marked with *

0
cart-icon