Recombinant Human APOO protein, GST-tagged
Cat.No. : | APOO-719H |
Product Overview : | Human APOO full-length ORF (BAG34806.1, 1 a.a. - 198 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene is a member of the apolipoprotein family. Members of this protein family are involved in the transport and metabolism of lipids. The encoded protein associates with HDL, LDL and VLDL lipoproteins and is characterized by chondroitin-sulfate glycosylation. This protein may be involved in preventing lipid accumulation in the myocardium in obese and diabetic patients. Alternative splicing results in multiple transcript variants. Pseudogenes of this gene are found on chromosomes 3, 4, 5, 12 and 16.[provided by RefSeq, Sep 2009] |
Molecular Mass : | 48.18 kDa |
AA Sequence : | MFKVIQRSVGPASLSLLTFKVYAAPKKDSPPKNSVKVDELSLYSVPEGQSKYVEEARSQLEESISQLRHYCEPYTTWCQETYSQTKPKMQSLVQWGLDSYDYLQNAPPGFFPRLGVIGFAGLIGLLLARGSKIKKLVYPPGFMGLAASLYYPQQAIVFAQVSGERLYDWGLRGYIVIEDLWKENFQKPGNVKNSPGTK |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | APOO apolipoprotein O [ Homo sapiens ] |
Official Symbol | APOO |
Synonyms | APOO; apolipoprotein O; FAM121B, family with sequence similarity 121B; MGC4825; My025; brain my025; family with sequence similarity 121B; FAM121B; |
Gene ID | 79135 |
mRNA Refseq | NM_024122 |
Protein Refseq | NP_077027 |
MIM | 300753 |
UniProt ID | Q9BUR5 |
◆ Recombinant Proteins | ||
APOO-1299HF | Recombinant Full Length Human APOO Protein, GST-tagged | +Inquiry |
APOO-4268H | Recombinant Human APOO Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Apoo-1665M | Recombinant Mouse Apoo Protein, Myc/DDK-tagged | +Inquiry |
APOO-1810M | Recombinant Mouse APOO Protein | +Inquiry |
APOO-642M | Recombinant Mouse APOO Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
APOO-8774HCL | Recombinant Human APOO 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All APOO Products
Required fields are marked with *
My Review for All APOO Products
Required fields are marked with *
0
Inquiry Basket