Recombinant Human APOO Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : APOO-4268H
Product Overview : APOO MS Standard C13 and N15-labeled recombinant protein (NP_077027) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : This gene is a member of the apolipoprotein family. Members of this protein family are involved in the transport and metabolism of lipids. The encoded protein associates with HDL, LDL and VLDL lipoproteins and is characterized by chondroitin-sulfate glycosylation. This protein may be involved in preventing lipid accumulation in the myocardium in obese and diabetic patients. Alternative splicing results in multiple transcript variants. Pseudogenes of this gene are found on chromosomes 3, 4, 5, 12 and 16.
Molecular Mass : 22.3 kDa
AA Sequence : MFKVIQRSVGPASLSLLTFKVYAAPKKDSPPKNSVKVDELSLYSVPEGQSKYVEEARSQLEESISQLRHYCEPYTTWCQETYSQTKPKMQSLVQWGLDSYDYLQNAPPGFFPRLGVIGFAGLIGLLLARGSKIKKLVYPPGFMGLAASLYYPQQAIVFAQVSGERLYDWGLRGYIVIEDLWKENFQKPGNVKNSPGTKTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name APOO apolipoprotein O [ Homo sapiens (human) ]
Official Symbol APOO
Synonyms APOO; apolipoprotein O; FAM121B, family with sequence similarity 121B; MGC4825; My025; brain my025; family with sequence similarity 121B; FAM121B;
Gene ID 79135
mRNA Refseq NM_024122
Protein Refseq NP_077027
MIM 300753
UniProt ID Q9BUR5

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All APOO Products

Required fields are marked with *

My Review for All APOO Products

Required fields are marked with *

0

Inquiry Basket

cartIcon