Recombinant Human APOO Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | APOO-4268H |
Product Overview : | APOO MS Standard C13 and N15-labeled recombinant protein (NP_077027) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene is a member of the apolipoprotein family. Members of this protein family are involved in the transport and metabolism of lipids. The encoded protein associates with HDL, LDL and VLDL lipoproteins and is characterized by chondroitin-sulfate glycosylation. This protein may be involved in preventing lipid accumulation in the myocardium in obese and diabetic patients. Alternative splicing results in multiple transcript variants. Pseudogenes of this gene are found on chromosomes 3, 4, 5, 12 and 16. |
Molecular Mass : | 22.3 kDa |
AA Sequence : | MFKVIQRSVGPASLSLLTFKVYAAPKKDSPPKNSVKVDELSLYSVPEGQSKYVEEARSQLEESISQLRHYCEPYTTWCQETYSQTKPKMQSLVQWGLDSYDYLQNAPPGFFPRLGVIGFAGLIGLLLARGSKIKKLVYPPGFMGLAASLYYPQQAIVFAQVSGERLYDWGLRGYIVIEDLWKENFQKPGNVKNSPGTKTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | APOO apolipoprotein O [ Homo sapiens (human) ] |
Official Symbol | APOO |
Synonyms | APOO; apolipoprotein O; FAM121B, family with sequence similarity 121B; MGC4825; My025; brain my025; family with sequence similarity 121B; FAM121B; |
Gene ID | 79135 |
mRNA Refseq | NM_024122 |
Protein Refseq | NP_077027 |
MIM | 300753 |
UniProt ID | Q9BUR5 |
◆ Recombinant Proteins | ||
APOO-642M | Recombinant Mouse APOO Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL-26569MF | Recombinant Full Length Mouse Apolipoprotein O(Apoo) Protein, His-Tagged | +Inquiry |
APOO-719H | Recombinant Human APOO protein, GST-tagged | +Inquiry |
APOO-1299HF | Recombinant Full Length Human APOO Protein, GST-tagged | +Inquiry |
APOO-8200H | Recombinant Human APOO protein, His & T7-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
APOO-8774HCL | Recombinant Human APOO 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All APOO Products
Required fields are marked with *
My Review for All APOO Products
Required fields are marked with *
0
Inquiry Basket