Recombinant Human APOOL protein, GST-tagged
| Cat.No. : | APOOL-720H |
| Product Overview : | Human APOOL full-length ORF ( NP_940852.3, 1 a.a. - 268 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | This gene encodes a protein which contains an apolipoprotein O superfamily domain. This domain is found on proteins in circulating lipoprotein complexes. [provided by RefSeq, Sep 2011] |
| Molecular Mass : | 55.6 kDa |
| AA Sequence : | MAAIRMGKLTTMPAGLIYASVSVHAAKQEESKKQLVKPEQLPIYTAPPLQSKYVEEQPGHLQMGFASIRTATGCYIGWCKGVYVFVKNGIMDTVQFGKDAYVYLKNPPRDFLPKMGVITVSGLAGLVSARKGSKFKKITYPLGLATLGATVCYPVQSVIIAKVTAKKVYATSQQIFGAVKSLWTKSSKEESLPKPKEKTKLGSSSEIEVPAKTTHVLKHSVPLPTELSSEAKTKSESTSGATQFMPDPKLMDHGQSHPEDIDMYSTRS |
| Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | APOOL apolipoprotein O-like [ Homo sapiens ] |
| Official Symbol | APOOL |
| Synonyms | APOOL; apolipoprotein O-like; chromosome X open reading frame 33 , CXorf33, FAM121A, family with sequence similarity 121A; AAIR8193; UNQ8193; family with sequence similarity 121A; CXorf33; FAM121A; MGC129748; |
| Gene ID | 139322 |
| mRNA Refseq | NM_198450 |
| Protein Refseq | NP_940852 |
| UniProt ID | Q6UXV4 |
| ◆ Recombinant Proteins | ||
| APOOL-1575C | Recombinant Chicken APOOL | +Inquiry |
| APOOL-720H | Recombinant Human APOOL protein, GST-tagged | +Inquiry |
| APOOL-1353HF | Recombinant Full Length Human APOOL Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| APOOL-8773HCL | Recombinant Human APOOL 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All APOOL Products
Required fields are marked with *
My Review for All APOOL Products
Required fields are marked with *
