Recombinant Human APOOL protein, GST-tagged

Cat.No. : APOOL-720H
Product Overview : Human APOOL full-length ORF ( NP_940852.3, 1 a.a. - 268 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a protein which contains an apolipoprotein O superfamily domain. This domain is found on proteins in circulating lipoprotein complexes. [provided by RefSeq, Sep 2011]
Molecular Mass : 55.6 kDa
AA Sequence : MAAIRMGKLTTMPAGLIYASVSVHAAKQEESKKQLVKPEQLPIYTAPPLQSKYVEEQPGHLQMGFASIRTATGCYIGWCKGVYVFVKNGIMDTVQFGKDAYVYLKNPPRDFLPKMGVITVSGLAGLVSARKGSKFKKITYPLGLATLGATVCYPVQSVIIAKVTAKKVYATSQQIFGAVKSLWTKSSKEESLPKPKEKTKLGSSSEIEVPAKTTHVLKHSVPLPTELSSEAKTKSESTSGATQFMPDPKLMDHGQSHPEDIDMYSTRS
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name APOOL apolipoprotein O-like [ Homo sapiens ]
Official Symbol APOOL
Synonyms APOOL; apolipoprotein O-like; chromosome X open reading frame 33 , CXorf33, FAM121A, family with sequence similarity 121A; AAIR8193; UNQ8193; family with sequence similarity 121A; CXorf33; FAM121A; MGC129748;
Gene ID 139322
mRNA Refseq NM_198450
Protein Refseq NP_940852
UniProt ID Q6UXV4

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All APOOL Products

Required fields are marked with *

My Review for All APOOL Products

Required fields are marked with *

0
cart-icon