Recombinant Human APP protein(672-711 aa)
Cat.No. : | APP-2551H |
Product Overview : | Recombinant Human APP protein(P05067)(672-711 aa) was synthesized. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Others |
Tag : | Non |
Protein Length : | 672-711 aa |
Form : | The polypeptide was dissolved in DMSO |
Molecular Mass : | 4.5 kDa |
Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
AA Sequence : | YEVHHQKLVFFAEDVGSNKGAIIGLMVGGV |
Gene Name | APP amyloid beta (A4) precursor protein [ Homo sapiens ] |
Official Symbol | APP |
Synonyms | APP; amyloid beta (A4) precursor protein; AD1, Alzheimer disease; amyloid beta A4 protein; peptidase nexin II; preA4; protease nexin-II; peptidase nexin-II; beta-amyloid peptide; alzheimer disease amyloid protein; cerebral vascular amyloid peptide; AAA; AD1; PN2; ABPP; APPI; CVAP; ABETA; PN-II; CTFgamma; |
Gene ID | 351 |
mRNA Refseq | NM_000484 |
Protein Refseq | NP_000475 |
MIM | 104760 |
UniProt ID | P05067 |
◆ Recombinant Proteins | ||
APP-3850H | Recombinant Human APP, His & GST-tagged | +Inquiry |
App-3440M | Recombinant Mouse App, His-tagged | +Inquiry |
APP-243H | Recombinant Human APP protein, MYC/DDK-tagged | +Inquiry |
APP-4261H | Recombinant Human APP Protein (Met1-Leu613), C-Fc tagged | +Inquiry |
APP-3234H | Recombinant Human APP protein(Asp672-Gly709), His&GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
APP-3087HCL | Recombinant Human APP cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All APP Products
Required fields are marked with *
My Review for All APP Products
Required fields are marked with *