Recombinant Human APP protein(672-711 aa)
Cat.No. : | APP-2551H |
Product Overview : | Recombinant Human APP protein(P05067)(672-711 aa) was synthesized. |
- Specification
- Gene Information
- Related Products
Source : | Others |
Species : | Human |
Tag : | tag free |
Protein length : | 672-711 aa |
Form : | The polypeptide was dissolved in DMSO |
Molecular Mass : | 4.5 kDa |
AASequence : | YEVHHQKLVFFAEDVGSNKGAIIGLMVGGV |
Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
Gene Name : | APP amyloid beta (A4) precursor protein [ Homo sapiens ] |
Official Symbol : | APP |
Synonyms : | APP; amyloid beta (A4) precursor protein; AD1, Alzheimer disease; amyloid beta A4 protein; peptidase nexin II; preA4; protease nexin-II; peptidase nexin-II; beta-amyloid peptide; alzheimer disease amyloid protein; cerebral vascular amyloid peptide; AAA; AD1; PN2; ABPP; APPI; CVAP; ABETA; PN-II; CTFgamma; |
Gene ID : | 351 |
mRNA Refseq : | NM_000484 |
Protein Refseq : | NP_000475 |
MIM : | 104760 |
UniProt ID : | P05067 |
Products Types
◆ Recombinant Protein | ||
APP-2488H | Recombinant Human APP Protein, His (Fc)-Avi-tagged | +Inquiry |
APP-643M | Recombinant Mouse APP Protein, His (Fc)-Avi-tagged | +Inquiry |
APP-23H | Active Recombinant Human APP Protein (18-701aa), C-His tagged | +Inquiry |
APP-2552H | Recombinant Human APP protein(672-713 aa) | +Inquiry |
App-1666M | Recombinant Mouse App Protein, Myc/DDK-tagged | +Inquiry |
◆ Lysates | ||
APP-3087HCL | Recombinant Human APP cell lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket