Recombinant Human APP protein(672-713 aa)

• Cat.No.: APP-2552H
• Product Overview: Recombinant Human APP protein(P05067)(672-713 aa) was synthesized.

Specification

• Source: Others
• Species: Human
• Tag: tag free
• Protein length: 672-713 aa
• Form: 0.15 M Phosphate buffered saline
• Molecular Mass: 4.5 kDa
• AASequence: YEVHHQKLVFFAEDVGSNKGAIIGLMVGGV
• Storage: Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
  Up to 12 months when aliquoted and stored at -20 to -80°C.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.

Gene Information

• Gene Name: APP amyloid beta (A4) precursor protein [ Homo sapiens ]
• Official Symbol: APP
• Synonyms: APP; amyloid beta (A4) precursor protein; AD1, Alzheimer disease; amyloid beta A4 protein; peptidase nexin II; preA4; protease nexin-II; peptidase nexin-II; beta-amyloid peptide; alzheimer disease amyloid protein; cerebral vascular amyloid peptide; AAA; AD1; PN2; ABPP; APPI; CVAP; ABETA; PN-II; CTFgamma
• Gene ID: 351
• mRNA Refseq: NM_000484
• Protein Refseq: NP_000475
• MIM: 104760
• UniProt ID: P05067