Recombinant Human APP protein(672-713 aa)

Cat.No. : APP-2552H
Product Overview : Recombinant Human APP protein(P05067)(672-713 aa) was synthesized.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Others
Tag : Non
Protein Length : 672-713 aa
Form : 0.15 M Phosphate buffered saline
Molecular Mass : 4.5 kDa
Storage : Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
Up to 12 months when aliquoted and stored at -20 to -80°C.
Reconstitution : It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
AA Sequence : YEVHHQKLVFFAEDVGSNKGAIIGLMVGGV
Gene Name APP amyloid beta (A4) precursor protein [ Homo sapiens ]
Official Symbol APP
Synonyms APP; amyloid beta (A4) precursor protein; AD1, Alzheimer disease; amyloid beta A4 protein; peptidase nexin II; preA4; protease nexin-II; peptidase nexin-II; beta-amyloid peptide; alzheimer disease amyloid protein; cerebral vascular amyloid peptide; AAA; AD1; PN2; ABPP; APPI; CVAP; ABETA; PN-II; CTFgamma;
Gene ID 351
mRNA Refseq NM_000484
Protein Refseq NP_000475
MIM 104760
UniProt ID P05067

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All APP Products

Required fields are marked with *

My Review for All APP Products

Required fields are marked with *

0

Inquiry Basket

cartIcon