Recombinant Human APPL protein, GST-tagged

Cat.No. : APPL-724H
Product Overview : Human APPL partial ORF ( NP_036228, 611 a.a. - 708 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The protein encoded by this gene has been shown to be involved in the regulation of cell proliferation, and in the crosstalk between the adiponectin signalling and insulin signalling pathways. The encoded protein binds many other proteins, including RAB5A, DCC, AKT2, PIK3CA, adiponectin receptors, and proteins of the NuRD/MeCP1 complex. This protein is found associated with endosomal membranes, but can be released by EGF and translocated to the nucleus. [provided by RefSeq, Jul 2008]
Molecular Mass : 36.52 kDa
AA Sequence : EGEKICDSVGLAKQIALHAELDRRASEKQKEIERVKEKQQKELNKQKQIEKDLEEQSRLIAASSRPNQASSEGQFVVLSSSQSEESDLGEGGKKRESE
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name APPL1 adaptor protein, phosphotyrosine interaction, PH domain and leucine zipper containing 1 [ Homo sapiens ]
Official Symbol APPL1
Synonyms APPL1; adaptor protein, phosphotyrosine interaction, PH domain and leucine zipper containing 1; DCC-interacting protein 13-alpha; APPL; dip13-alpha; AKT2 interactor; signaling adaptor protein DIP13alpha; adapter protein containing PH domain, PTB domain and leucine zipper motif 1; adaptor protein containing pH domain, PTB domain and leucine zipper motif 1; DIP13alpha;
Gene ID 26060
mRNA Refseq NM_012096
Protein Refseq NP_036228
MIM 604299
UniProt ID Q9UKG1

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All APPL1 Products

Required fields are marked with *

My Review for All APPL1 Products

Required fields are marked with *

0
cart-icon
0
compare icon