Recombinant Human APPL protein, GST-tagged
| Cat.No. : | APPL-724H |
| Product Overview : | Human APPL partial ORF ( NP_036228, 611 a.a. - 708 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | The protein encoded by this gene has been shown to be involved in the regulation of cell proliferation, and in the crosstalk between the adiponectin signalling and insulin signalling pathways. The encoded protein binds many other proteins, including RAB5A, DCC, AKT2, PIK3CA, adiponectin receptors, and proteins of the NuRD/MeCP1 complex. This protein is found associated with endosomal membranes, but can be released by EGF and translocated to the nucleus. [provided by RefSeq, Jul 2008] |
| Molecular Mass : | 36.52 kDa |
| AA Sequence : | EGEKICDSVGLAKQIALHAELDRRASEKQKEIERVKEKQQKELNKQKQIEKDLEEQSRLIAASSRPNQASSEGQFVVLSSSQSEESDLGEGGKKRESE |
| Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | APPL1 adaptor protein, phosphotyrosine interaction, PH domain and leucine zipper containing 1 [ Homo sapiens ] |
| Official Symbol | APPL1 |
| Synonyms | APPL1; adaptor protein, phosphotyrosine interaction, PH domain and leucine zipper containing 1; DCC-interacting protein 13-alpha; APPL; dip13-alpha; AKT2 interactor; signaling adaptor protein DIP13alpha; adapter protein containing PH domain, PTB domain and leucine zipper motif 1; adaptor protein containing pH domain, PTB domain and leucine zipper motif 1; DIP13alpha; |
| Gene ID | 26060 |
| mRNA Refseq | NM_012096 |
| Protein Refseq | NP_036228 |
| MIM | 604299 |
| UniProt ID | Q9UKG1 |
| ◆ Recombinant Proteins | ||
| APPL1-16H | Recombinant Human APPL1 Protein, MYC/DDK-tagged | +Inquiry |
| APPL1-26345TH | Recombinant Human APPL1, His-tagged | +Inquiry |
| APPL1-9774H | Recombinant Human APPL1, GST-tagged | +Inquiry |
| APPL-724H | Recombinant Human APPL protein, GST-tagged | +Inquiry |
| Appl1-1667M | Recombinant Mouse Appl1 Protein, Myc/DDK-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| APPL1-8772HCL | Recombinant Human APPL1 293 Cell Lysate | +Inquiry |
| APPL1-046HKCL | Human APPL1 Knockdown Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All APPL1 Products
Required fields are marked with *
My Review for All APPL1 Products
Required fields are marked with *



