Recombinant Human AQP4 Protein, His-SUMO-tagged
| Cat.No. : | AQP4-1131H |
| Product Overview : | Recombinant Human AQP4 Protein (253-323aa) was expressed in E. coli with N-terminal His-SUMO tag. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&SUMO |
| Protein Length : | 253-323 a.a. |
| Form : | Tris-based buffer, 50% glycerol. |
| Molecular Mass : | 24 kDa |
| AA Sequence : | CPDVEFKRRFKEAFSKAAQQTKGSYMEVEDNRSQVETDDLILKPGVVHVIDVDRGEEKKGKDQSGEVLSSV |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Gene Name | AQP4 aquaporin 4 [ Homo sapiens ] |
| Official Symbol | AQP4 |
| Synonyms | AQP4; aquaporin 4; aquaporin-4; MIWC; WCH4; aquaporin type4; mercurial-insensitive water channel; HMIWC2; MGC22454 |
| Gene ID | 361 |
| mRNA Refseq | NM_001650 |
| Protein Refseq | NP_001641 |
| MIM | 600308 |
| UniProt ID | P55087 |
| ◆ Recombinant Proteins | ||
| AQP4-1157HF | Recombinant Full Length Human AQP4 Protein, GST-tagged | +Inquiry |
| RFL5552NF | Recombinant Full Length Notomys Alexis Aquaporin-4(Aqp4) Protein, His-Tagged | +Inquiry |
| AQP4-0294H | Recombinant Human AQP4 Protein (Met23-Val323), C-GFP-tagged | +Inquiry |
| AQP4-9735H | Recombinant Human AQP4 protein, His-GST-tagged | +Inquiry |
| Aqp4-1049M | Recombinant Mouse Aqp4 Full Length Transmembrane protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| AQP4-32HCL | Recombinant Human AQP4 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All AQP4 Products
Required fields are marked with *
My Review for All AQP4 Products
Required fields are marked with *
