Recombinant Human AQP4 protein, His-tagged
| Cat.No. : | AQP4-3447H |
| Product Overview : | Recombinant Human AQP4 protein(208-323 aa), fused to His tag, was expressed in E. coli. |
| Availability | January 12, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 208-323 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | TGASMNPARSFGPAVIMGNWENHWIYWVGPIIGAVLAGGLYEYVFCPDVEFKRRFKEAFSKAAQQTKGSYMEVEDNRSQVETDDLILKPGVVHVIDVDRGEEKKGKDQSGEVLSSV |
| Purity : | 98%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | AQP4 aquaporin 4 [ Homo sapiens ] |
| Official Symbol | AQP4 |
| Synonyms | AQP4; aquaporin 4; aquaporin-4; MIWC; WCH4; aquaporin type4; mercurial-insensitive water channel; HMIWC2; MGC22454; |
| Gene ID | 361 |
| mRNA Refseq | NM_001650 |
| Protein Refseq | NP_001641 |
| MIM | 600308 |
| UniProt ID | P55087 |
| ◆ Recombinant Proteins | ||
| AQP4-3594M | Recombinant Mouse Aqp4 protein, His-tagged | +Inquiry |
| AQP4-2226M | Recombinant Mouse AQP4 Protein (253-323 aa), His-tagged | +Inquiry |
| AQP4-374R | Recombinant Rhesus monkey AQP4 Protein, His-tagged | +Inquiry |
| AQP4-3447H | Recombinant Human AQP4 protein, His-tagged | +Inquiry |
| AQP4-9782H | Recombinant Human AQP4, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| AQP4-32HCL | Recombinant Human AQP4 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All AQP4 Products
Required fields are marked with *
My Review for All AQP4 Products
Required fields are marked with *
