Recombinant Human AQP4 protein, His-tagged
Cat.No. : | AQP4-3447H |
Product Overview : | Recombinant Human AQP4 protein(208-323 aa), fused to His tag, was expressed in E. coli. |
Availability | July 04, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 208-323 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | TGASMNPARSFGPAVIMGNWENHWIYWVGPIIGAVLAGGLYEYVFCPDVEFKRRFKEAFSKAAQQTKGSYMEVEDNRSQVETDDLILKPGVVHVIDVDRGEEKKGKDQSGEVLSSV |
Purity : | 98%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | AQP4 aquaporin 4 [ Homo sapiens ] |
Official Symbol | AQP4 |
Synonyms | AQP4; aquaporin 4; aquaporin-4; MIWC; WCH4; aquaporin type4; mercurial-insensitive water channel; HMIWC2; MGC22454; |
Gene ID | 361 |
mRNA Refseq | NM_001650 |
Protein Refseq | NP_001641 |
MIM | 600308 |
UniProt ID | P55087 |
◆ Recombinant Proteins | ||
AQP4-1236C | Recombinant Chicken AQP4 | +Inquiry |
AQP4-1131H | Recombinant Human AQP4 Protein, His-SUMO-tagged | +Inquiry |
RFL-28054BF | Recombinant Full Length Bovine Aquaporin-4(Aqp4) Protein, His-Tagged | +Inquiry |
Aqp4-1048M | Recombinant Mouse Aqp4 Full Length Transmembrane protein | +Inquiry |
AQP4-1088Z | Recombinant Zebrafish AQP4 | +Inquiry |
◆ Cell & Tissue Lysates | ||
AQP4-32HCL | Recombinant Human AQP4 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All AQP4 Products
Required fields are marked with *
My Review for All AQP4 Products
Required fields are marked with *