Recombinant Human AQP5 protein, His-KSI-tagged
Cat.No. : | AQP5-6123H |
Product Overview : | Recombinant Human AQP5 protein(P55064)(225-265aa), fused with N-terminal His and KSI tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&KSI |
Protein Length : | 225-265a.a. |
Tag : | His-KSI |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 20.3 kDa |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | LFPNSLSLSERVAIIKGTYEPDEDWEEQREERKKTMELTTR |
Gene Name | AQP5 aquaporin 5 [ Homo sapiens ] |
Official Symbol | AQP5 |
Synonyms | AQP5; aquaporin 5; aquaporin-5; AQP-5; |
Gene ID | 362 |
mRNA Refseq | NM_001651 |
Protein Refseq | NP_001642 |
MIM | 600442 |
UniProt ID | P55064 |
◆ Recombinant Proteins | ||
AQP5-650M | Recombinant Mouse AQP5 Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL-9581RF | Recombinant Full Length Rat Aquaporin-5(Aqp5) Protein, His-Tagged | +Inquiry |
RFL-19211HF | Recombinant Full Length Human Aquaporin-5(Aqp5) Protein, His-Tagged | +Inquiry |
RFL-32166SF | Recombinant Full Length Pig Aquaporin-5(Aqp5) Protein, His-Tagged | +Inquiry |
AQP5-0403H | Recombinant Human AQP5 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
AQP5-33HCL | Recombinant Human AQP5 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All AQP5 Products
Required fields are marked with *
My Review for All AQP5 Products
Required fields are marked with *
0
Inquiry Basket