Recombinant Human AQP5 protein, His-tagged
Cat.No. : | AQP5-0403H |
Product Overview : | Recombinant Human AQP5 protein(190-265 aa), fused to His tag, was expressed in E. coli. |
Availability | April 30, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 190-265 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | FGPAVVMNRFSPAHWVFWVGPIVGAVLAAILYFYLLFPNSLSLSERVAIIKGTYEPDEDWEEQREERKKTMELTTR |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | AQP5 aquaporin 5 [ Homo sapiens ] |
Official Symbol | AQP5 |
Synonyms | AQP5; aquaporin 5; aquaporin-5; AQP-5; |
Gene ID | 362 |
mRNA Refseq | NM_001651 |
Protein Refseq | NP_001642 |
MIM | 600442 |
UniProt ID | P55064 |
◆ Recombinant Proteins | ||
AQP5-0403H | Recombinant Human AQP5 protein, His-tagged | +Inquiry |
AQP5-1824M | Recombinant Mouse AQP5 Protein | +Inquiry |
AQP5-222H | Recombinant Human AQP5 Full Length Transmembrane protein, His-tagged | +Inquiry |
AQP5-236H | Recombinant Human AQP5 Protein, His-tagged | +Inquiry |
RFL34575OF | Recombinant Full Length Sheep Aquaporin-5(Aqp5) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
AQP5-33HCL | Recombinant Human AQP5 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All AQP5 Products
Required fields are marked with *
My Review for All AQP5 Products
Required fields are marked with *
0
Inquiry Basket