Recombinant Human AQP6 protein, GST-tagged
| Cat.No. : | AQP6-301468H |
| Product Overview : | Recombinant Human AQP6 (221-282 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | Met221-Val282 |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
| AA Sequence : | MLMGALLASLIYNFVLFPDTKTLAQRLAILTGTVEVGTGAGAGAEPLKKESQPGSGAVEMESV |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Gene Name | AQP6 aquaporin 6, kidney specific [ Homo sapiens ] |
| Official Symbol | AQP6 |
| Synonyms | AQP6; aquaporin 6, kidney specific; AQP2L; aquaporin-6; hKID; AQP-6; kidney-specific aquaporin; aquaporin-6, kidney specific; aquaporin 2-like, kidney specific; KID; |
| Gene ID | 363 |
| mRNA Refseq | NM_001652 |
| Protein Refseq | NP_001643 |
| MIM | 601383 |
| UniProt ID | Q13520 |
| ◆ Recombinant Proteins | ||
| AQP6-2680H | Recombinant Human AQP6 protein, His-tagged | +Inquiry |
| RFL17928HF | Recombinant Full Length Human Aquaporin-6(Aqp6) Protein, His-Tagged | +Inquiry |
| AQP6-396R | Recombinant Rat AQP6 Protein, His (Fc)-Avi-tagged | +Inquiry |
| RFL8222MF | Recombinant Full Length Mouse Aquaporin-6(Aqp6) Protein, His-Tagged | +Inquiry |
| RFL27637RF | Recombinant Full Length Rat Aquaporin-6(Aqp6) Protein, His-Tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| AQP6-8766HCL | Recombinant Human AQP6 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All AQP6 Products
Required fields are marked with *
My Review for All AQP6 Products
Required fields are marked with *




