Recombinant Human AQP6 protein, His-tagged
Cat.No. : | AQP6-2680H |
Product Overview : | Recombinant Human AQP6 protein(221 - 282 aa), fused to His tag, was expressed in E. coli. |
Availability | June 13, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 221 - 282 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | MLMGALLASLIYNFVLFPDTKTLAQRLAILTGTVEVGTGAGAGAEPLKKESQPGSGAVEMESV |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | AQP6 aquaporin 6, kidney specific [ Homo sapiens ] |
Official Symbol | AQP6 |
Synonyms | AQP6; aquaporin 6, kidney specific; AQP2L; aquaporin-6; hKID; AQP-6; kidney-specific aquaporin; aquaporin-6, kidney specific; aquaporin 2-like, kidney specific; KID; |
Gene ID | 363 |
mRNA Refseq | NM_001652 |
Protein Refseq | NP_001643 |
MIM | 601383 |
UniProt ID | Q13520 |
◆ Recombinant Proteins | ||
AQP6-651M | Recombinant Mouse AQP6 Protein, His (Fc)-Avi-tagged | +Inquiry |
AQP6-2680H | Recombinant Human AQP6 protein, His-tagged | +Inquiry |
AQP6-740R | Recombinant Rat AQP6 Protein | +Inquiry |
RFL8222MF | Recombinant Full Length Mouse Aquaporin-6(Aqp6) Protein, His-Tagged | +Inquiry |
AQP6-1825M | Recombinant Mouse AQP6 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
AQP6-8766HCL | Recombinant Human AQP6 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All AQP6 Products
Required fields are marked with *
My Review for All AQP6 Products
Required fields are marked with *
0
Inquiry Basket