Recombinant Human ARAF protein, His-tagged
| Cat.No. : | ARAF-186H |
| Product Overview : | Recombinant Human ARAF(225 - 324 aa) fused with His tag at N-terminal was expressed in E. coli. |
| Availability | January 07, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 225 - 324 aa |
| Description : | This proto-oncogene belongs to the RAF subfamily of the Ser/Thr protein kinase family, and maybe involved in cell growth and development. Alternatively spliced transcript variants encoding different isoforms have been found for this gene |
| Form : | Protein lyophilized in sterile PBS (58 mM Na2HPO4, 17 mM NaH2PO4, 68 mM NaCl, 300 mM Imidazole, pH 8.0). Trehalose (5-8%) and mannitol (5-8%) protectants were added before lyophilization. |
| AA Sequence : | STTAPMDSNLIQLTGQSFSTDAAGSRGGSDGTPRGSPSPASVSSGRKSPHSKSPAEQRERKSLADDKKKVKNLGY RDSGYYWEVPPSEVQLLKRIGTGSF |
| Purity : | > 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Store for up to 12 months at -20 centigradeto -80 centigradeas lyophilized powder.Storage of Reconstituted Protein:Short-term storage: Store at 2-8 centigradefor two weeks.Long-term storage: Aliquot and store at -20 centigradeto -80 centigradefor up to 6 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage (see Stability and Storage for more details).If a different concentration is needed for your purposes please adjust the reconstitution volume as required (please note: the ion concentration of the final solution will vary according to the volume used).Note: Centrifuge vial before opening. When reconstituting, gently pipet and wash down the sides of the vial to ensure full recovery of the protein into solution. |
| Shipping : | The product is shipped at ambient temperature. Upon receipt, store it immediately at the recommended temperature (see below). |
| Gene Name | ARAF v-raf murine sarcoma 3611 viral oncogene homolog [ Homo sapiens ] |
| Official Symbol | ARAF |
| Synonyms | ARAF; v-raf murine sarcoma 3611 viral oncogene homolog; ARAF1, v raf murine sarcoma 3611 viral oncogene homolog 1; serine/threonine-protein kinase A-Raf; Oncogene ARAF1; proto-oncogene Pks; proto-oncogene A-Raf-1; Ras-binding protein DA-Raf; v-raf murine sarcoma 3611 viral oncogene homolog 1; A-Raf proto-oncogene serine/threonine-protein kinase; PKS2; A-RAF; ARAF1; RAFA1; |
| Gene ID | 369 |
| mRNA Refseq | NM_001256196 |
| Protein Refseq | NP_001243125 |
| MIM | 311010 |
| UniProt ID | P10398 |
| Chromosome Location | Xp11.3-p11.23 |
| Pathway | Acute myeloid leukemia, organism-specific biosystem; Acute myeloid leukemia, conserved biosystem; Bladder cancer, organism-specific biosystem; Bladder cancer, conserved biosystem; Chronic myeloid leukemia, organism-specific biosystem; Chronic myeloid leukemia, conserved biosystem; Colorectal cancer, organism-specific biosystem; |
| Function | ATP binding; metal ion binding; nucleotide binding; protein binding; protein kinase activity; protein serine/threonine kinase activity; protein serine/threonine kinase activity; receptor signaling protein activity; |
| ◆ Recombinant Proteins | ||
| ARAF-11758Z | Recombinant Zebrafish ARAF | +Inquiry |
| ARAF-239H | Recombinant Human ARAF Protein, His-tagged | +Inquiry |
| ARAF-26034TH | Recombinant Human ARAF | +Inquiry |
| ARAF-654M | Recombinant Mouse ARAF Protein, His (Fc)-Avi-tagged | +Inquiry |
| ARAF-1524HF | Recombinant Full Length Human ARAF Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ARAF-105HCL | Recombinant Human ARAF cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ARAF Products
Required fields are marked with *
My Review for All ARAF Products
Required fields are marked with *
