Recombinant Human ARAF protein, His-tagged

PRODUCTS

Home / Products / Recombinant Proteins / Recombinant Human ARAF protein, His-tagged

Recombinant Human ARAF protein, His-tagged

ARAF Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : ARAF-186H
Product Overview : Recombinant Human ARAF(225 - 324 aa) fused with His tag at N-terminal was expressed in E. coli.
Description : This proto-oncogene belongs to the RAF subfamily of the Ser/Thr protein kinase family, and maybe involved in cell growth and development. Alternatively spliced transcript variants encoding different isoforms have been found for this gene
Source : E. coli
Species : Human
Tag : His
Form : Protein lyophilized in sterile PBS (58 mM Na2HPO4, 17 mM NaH2PO4, 68 mM NaCl, 300 mM Imidazole, pH 8.0). Trehalose (5-8%) and mannitol (5-8%) protectants were added before lyophilization.
Protein length : 225 - 324 aa
AA Sequence : STTAPMDSNLIQLTGQSFSTDAAGSRGGSDGTPRGSPSPASVSSGRKSPHSKSPAEQRERKSLADDKKKVKNLGY RDSGYYWEVPPSEVQLLKRIGTGSF
Purity : > 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Store for up to 12 months at -20 centigradeto -80 centigradeas lyophilized powder.Storage of Reconstituted Protein:Short-term storage: Store at 2-8 centigradefor two weeks.Long-term storage: Aliquot and store at -20 centigradeto -80 centigradefor up to 6 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage (see Stability and Storage for more details).If a different concentration is needed for your purposes please adjust the reconstitution volume as required (please note: the ion concentration of the final solution will vary according to the volume used).Note: Centrifuge vial before opening. When reconstituting, gently pipet and wash down the sides of the vial to ensure full recovery of the protein into solution.
Shipping : The product is shipped at ambient temperature. Upon receipt, store it immediately at the recommended temperature (see below).
Gene Name : ARAF v-raf murine sarcoma 3611 viral oncogene homolog [ Homo sapiens ]
Official Symbol : ARAF
Synonyms : ARAF; v-raf murine sarcoma 3611 viral oncogene homolog; ARAF1, v raf murine sarcoma 3611 viral oncogene homolog 1; serine/threonine-protein kinase A-Raf; Oncogene ARAF1; proto-oncogene Pks; proto-oncogene A-Raf-1; Ras-binding protein DA-Raf; v-raf murine sarcoma 3611 viral oncogene homolog 1; A-Raf proto-oncogene serine/threonine-protein kinase; PKS2; A-RAF; ARAF1; RAFA1;
Gene ID : 369
mRNA Refseq : NM_001256196
Protein Refseq : NP_001243125
MIM : 311010
UniProt ID : P10398
Chromosome Location : Xp11.3-p11.23
Pathway : Acute myeloid leukemia, organism-specific biosystem; Acute myeloid leukemia, conserved biosystem; Bladder cancer, organism-specific biosystem; Bladder cancer, conserved biosystem; Chronic myeloid leukemia, organism-specific biosystem; Chronic myeloid leukemia, conserved biosystem; Colorectal cancer, organism-specific biosystem;
Function : ATP binding; metal ion binding; nucleotide binding; protein binding; protein kinase activity; protein serine/threonine kinase activity; protein serine/threonine kinase activity; receptor signaling protein activity;

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved.