Recombinant Human ARAP2 protein, His-tagged
Cat.No. : | ARAP2-90H |
Product Overview : | Recombinant Human ARAP2 protein(Q8WZ64)(His81-Ser240), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | His81-Ser240 |
Tag : | C-His |
Form : | Phosphate buffered saline. |
Molecular Mass : | 19 kDa |
Storage : | Store at -20°C to -80°C. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
AA Sequence : | HKTKKNDDPSKDYHVPSSDQNICIELSNSGSVQTSSPPQLETVRKNLEDSDASVERSQYPQSDDKLSPPKRDFPTAEEPHLNLGSLNDSLFGSDNIKIESLITKKTVDHTVEEQQTEKVKLITENLSKLPNADSECLSFVGCSTSGTNSGNGTNGLLEGS |
Gene Name | ARAP2 ArfGAP with RhoGAP domain, ankyrin repeat and PH domain 2 [ Homo sapiens ] |
Official Symbol | ARAP2 |
Synonyms | ARAP2; ArfGAP with RhoGAP domain, ankyrin repeat and PH domain 2; centaurin, delta 1 , CENTD1; arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 2; PARX; cnt-d1; centaurin-delta-1; centaurin, delta 1; Arf and Rho GAP adapter protein 2; CENTD1; FLJ13675; FLJ44916; KIAA0580; |
Gene ID | 116984 |
mRNA Refseq | NM_015230 |
Protein Refseq | NP_056045 |
MIM | 606645 |
UniProt ID | Q8WZ64 |
◆ Recombinant Proteins | ||
ARAP2-9791H | Recombinant Human ARAP2, His-tagged | +Inquiry |
ARAP2-90H | Recombinant Human ARAP2 protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ARAP2 Products
Required fields are marked with *
My Review for All ARAP2 Products
Required fields are marked with *
0
Inquiry Basket