Recombinant Human ARAP2 protein, His-tagged

Cat.No. : ARAP2-90H
Product Overview : Recombinant Human ARAP2 protein(Q8WZ64)(His81-Ser240), fused with C-terminal His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : His81-Ser240
Tag : C-His
Form : Phosphate buffered saline.
Molecular Mass : 19 kDa
Storage : Store at -20°C to -80°C.
Reconstitution : It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
AA Sequence : HKTKKNDDPSKDYHVPSSDQNICIELSNSGSVQTSSPPQLETVRKNLEDSDASVERSQYPQSDDKLSPPKRDFPTAEEPHLNLGSLNDSLFGSDNIKIESLITKKTVDHTVEEQQTEKVKLITENLSKLPNADSECLSFVGCSTSGTNSGNGTNGLLEGS
Gene Name ARAP2 ArfGAP with RhoGAP domain, ankyrin repeat and PH domain 2 [ Homo sapiens ]
Official Symbol ARAP2
Synonyms ARAP2; ArfGAP with RhoGAP domain, ankyrin repeat and PH domain 2; centaurin, delta 1 , CENTD1; arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 2; PARX; cnt-d1; centaurin-delta-1; centaurin, delta 1; Arf and Rho GAP adapter protein 2; CENTD1; FLJ13675; FLJ44916; KIAA0580;
Gene ID 116984
mRNA Refseq NM_015230
Protein Refseq NP_056045
MIM 606645
UniProt ID Q8WZ64

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ARAP2 Products

Required fields are marked with *

My Review for All ARAP2 Products

Required fields are marked with *

0
cart-icon