Recombinant Human ARAP2 protein, His-tagged

• Cat.No.: ARAP2-90H
• Product Overview: Recombinant Human ARAP2 protein(Q8WZ64)(His81-Ser240), fused with C-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: His81-Ser240
• Tag: C-His
• Form: Phosphate buffered saline.
• Molecular Mass: 19 kDa
• Storage: Store at -20°C to -80°C.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
• AA Sequence: HKTKKNDDPSKDYHVPSSDQNICIELSNSGSVQTSSPPQLETVRKNLEDSDASVERSQYPQSDDKLSPPKRDFPTAEEPHLNLGSLNDSLFGSDNIKIESLITKKTVDHTVEEQQTEKVKLITENLSKLPNADSECLSFVGCSTSGTNSGNGTNGLLEGS

Gene Information

• Gene Name: ARAP2 ArfGAP with RhoGAP domain, ankyrin repeat and PH domain 2 [ Homo sapiens ]
• Official Symbol: ARAP2
• Synonyms: ARAP2; ArfGAP with RhoGAP domain, ankyrin repeat and PH domain 2; centaurin, delta 1 , CENTD1; arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 2; PARX; cnt-d1; centaurin-delta-1; centaurin, delta 1; Arf and Rho GAP adapter protein 2; CENTD1; FLJ13675; FLJ44916; KIAA0580
• Gene ID: 116984
• mRNA Refseq: NM_015230
• Protein Refseq: NP_056045
• MIM: 606645
• UniProt ID: Q8WZ64