Recombinant Human ARD1 protein, GST-tagged

• Cat.No.: ARD1-741H
• Product Overview: Human ARD1 full-length ORF ( AAH00308, 1 a.a. - 235 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: N-alpha-acetylation is among the most common post-translational protein modifications in eukaryotic cells. This process involves the transfer of an acetyl group from acetyl-coenzyme A to the alpha-amino group on a nascent polypeptide and is essential for normal cell function. This gene encodes an N-terminal acetyltransferase that functions as the catalytic subunit of the major amino-terminal acetyltransferase A complex. Mutations in this gene are the cause of Ogden syndrome. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Jan 2012]
• Molecular Mass: 51.59 kDa
• AA Sequence: MNIRNARPEDLMNMQHCNLLCLPENYQMKYYFYHGLSWPQLSYIAEDENGKIVGYVLAKMEEDPDDVPHGHITSLAVKRSHRRLGLAQKLMDQASRAMIENFNAKYVSLHVRKSNRAALHLYSNTLNFQISEVEPKYYADGEDAYAMKRDLTQMADELRRHLELKEKGRHVVLGAIENKVESKGNSPPSSGEACREEKGLAAEDSGGDSKDLSEVSETTESTDVKDSSEASDSAS
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: NAA10 N(alpha)-acetyltransferase 10, NatA catalytic subunit [ Homo sapiens ]
• Official Symbol: NAA10
• Synonyms: NAA10; N(alpha)-acetyltransferase 10, NatA catalytic subunit; ARD1, ARD1 homolog A, N acetyltransferase (S. cerevisiae) , ARD1 homolog, N acetyltransferase (S. cerevisiae) , ARD1A; N-alpha-acetyltransferase 10; DXS707; TE2; ARD1 homolog A, N-acetyltransferase; N-acetyltransferase ARD1, human homolog of; N-alpha-acetyltransferase 10, NatA catalytic subunit; N-terminal acetyltransferase complex ARD1 subunit homolog A; ARD1; NATD; ARD1A; FLJ78896; MGC71248
• Gene ID: 8260
• mRNA Refseq: NM_001256119
• Protein Refseq: NP_001243048
• MIM: 300013
• UniProt ID: P41227