Recombinant Human ARD1 protein, GST-tagged
Cat.No. : | ARD1-741H |
Product Overview : | Human ARD1 full-length ORF ( AAH00308, 1 a.a. - 235 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | N-alpha-acetylation is among the most common post-translational protein modifications in eukaryotic cells. This process involves the transfer of an acetyl group from acetyl-coenzyme A to the alpha-amino group on a nascent polypeptide and is essential for normal cell function. This gene encodes an N-terminal acetyltransferase that functions as the catalytic subunit of the major amino-terminal acetyltransferase A complex. Mutations in this gene are the cause of Ogden syndrome. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Jan 2012] |
Molecular Mass : | 51.59 kDa |
AA Sequence : | MNIRNARPEDLMNMQHCNLLCLPENYQMKYYFYHGLSWPQLSYIAEDENGKIVGYVLAKMEEDPDDVPHGHITSLAVKRSHRRLGLAQKLMDQASRAMIENFNAKYVSLHVRKSNRAALHLYSNTLNFQISEVEPKYYADGEDAYAMKRDLTQMADELRRHLELKEKGRHVVLGAIENKVESKGNSPPSSGEACREEKGLAAEDSGGDSKDLSEVSETTESTDVKDSSEASDSAS |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | NAA10 N(alpha)-acetyltransferase 10, NatA catalytic subunit [ Homo sapiens ] |
Official Symbol | NAA10 |
Synonyms | NAA10; N(alpha)-acetyltransferase 10, NatA catalytic subunit; ARD1, ARD1 homolog A, N acetyltransferase (S. cerevisiae) , ARD1 homolog, N acetyltransferase (S. cerevisiae) , ARD1A; N-alpha-acetyltransferase 10; DXS707; TE2; ARD1 homolog A, N-acetyltransferase; N-acetyltransferase ARD1, human homolog of; N-alpha-acetyltransferase 10, NatA catalytic subunit; N-terminal acetyltransferase complex ARD1 subunit homolog A; ARD1; NATD; ARD1A; FLJ78896; MGC71248; |
Gene ID | 8260 |
mRNA Refseq | NM_001256119 |
Protein Refseq | NP_001243048 |
MIM | 300013 |
UniProt ID | P41227 |
◆ Recombinant Proteins | ||
NAA10-3237H | Recombinant Human NAA10 protein(Met1-Ser235), His&GST-tagged | +Inquiry |
NAA10-1065HF | Recombinant Full Length Human NAA10 Protein, GST-tagged | +Inquiry |
NAA10-12519Z | Recombinant Zebrafish NAA10 | +Inquiry |
NAA10-1302H | Recombinant Human NAA10 protein(Met1-Ser235) | +Inquiry |
ARD1-741H | Recombinant Human ARD1 protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NAA10-001HCL | Recombinant Human NAA10 cell lysate | +Inquiry |
NAA10-002HCL | Recombinant Human NAA10 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NAA10 Products
Required fields are marked with *
My Review for All NAA10 Products
Required fields are marked with *
0
Inquiry Basket