Recombinant Human NAA10, His-tagged
| Cat.No. : | NAA10-26531TH |
| Product Overview : | Recombinant full length Human ARD1A with an N terminal His tag; 255 amino acids with tag, Predicted MWt 28.6 kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 235 amino acids |
| Description : | N-alpha-acetylation is one of the most common protein modifications that occurs during protein synthesis and involves the transfer of an acetyl group from acetyl-coenzyme A to the protein alpha-amino group. |
| Conjugation : | HIS |
| Molecular Weight : | 28.600kDa inclusive of tags |
| Tissue specificity : | Ubiquitous. |
| Form : | Liquid |
| Purity : | >90% by SDS-PAGE |
| Storage buffer : | pH: 8.00Constituents:0.32% Tris HCl, 0.08% DTT, 10% Glycerol, 1.17% Sodium chloride |
| Storage : | Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
| Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHMNIRNARPEDLMNMQHCNLL CLPENYQMKYYFYHGLSWPQLSYIAEDENGKIVGYVLA KMEEDPDDVPHGHITSLAVKRSHRRLGLAQKLMDQASRAM IENFNAKYVSLHVRKSNRAALHLYSNTLNFQISEVEPK YYADGEDAYAMKRDLTQMADELRRHLELKEKGRHVVLGAI ENKVESKGNSPPSSGEACREEKGLAAEDSGGDSKDLSE VSETTESTDVKDSSEASDSAS |
| Sequence Similarities : | Belongs to the acetyltransferase family. ARD1 subfamily.Contains 1 N-acetyltransferase domain. |
| Gene Name | NAA10 N(alpha)-acetyltransferase 10, NatA catalytic subunit [ Homo sapiens ] |
| Official Symbol | NAA10 |
| Synonyms | NAA10; N(alpha)-acetyltransferase 10, NatA catalytic subunit; ARD1, ARD1 homolog A, N acetyltransferase (S. cerevisiae) , ARD1 homolog, N acetyltransferase (S. cerevisiae) , ARD1A; N-alpha-acetyltransferase 10; DXS707; TE2; |
| Gene ID | 8260 |
| mRNA Refseq | NM_003491 |
| Protein Refseq | NP_003482 |
| MIM | 300013 |
| Uniprot ID | P41227 |
| Chromosome Location | Xq28 |
| Pathway | Hypoxic and oxygen homeostasis regulation of HIF-1-alpha, organism-specific biosystem; |
| Function | N-acetyltransferase activity; contributes_to acetyltransferase activity; peptide alpha-N-acetyltransferase activity; protein binding; contributes_to ribosome binding; |
| ◆ Recombinant Proteins | ||
| NAA10-1470H | Recombinant Human NAA10 Protein, His (Fc)-Avi-tagged | +Inquiry |
| NAA10-193H | Recombinant Human NAA10 Protein, MYC/DDK-tagged | +Inquiry |
| NAA10-8647H | Recombinant Human NAA10, His-GST tagged | +Inquiry |
| NAA10-1065HF | Recombinant Full Length Human NAA10 Protein, GST-tagged | +Inquiry |
| ARD1-741H | Recombinant Human ARD1 protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| NAA10-002HCL | Recombinant Human NAA10 cell lysate | +Inquiry |
| NAA10-001HCL | Recombinant Human NAA10 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NAA10 Products
Required fields are marked with *
My Review for All NAA10 Products
Required fields are marked with *
