Recombinant Human AREG protein, GST-tagged

• Cat.No.: AREG-1221H
• Product Overview: Recombinant Human AREG protein(25-252 aa), fused to GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 25-252 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH.
• AA Sequence: AGLDLNDTYSGKREPFSGDHSADGFEVTSRSEMSSGSEISPVSEMPSSSEPSSGADYDYSEEYDNEPQIPGYIVDDSVRVEQVVKPPQNKTESENTSDKPKRKKKGGKNGKNRRNRKKKNPCNAEFQNFCIHGECKYIEHLEAVTCKCQQEYFGERCGEKSMKTHSMIDSSLSKIALAAIAAFMSAVILTAVAVITVQLRRQYVRKYEGEAEERKKLRQENGNVHAIA
• Purity: 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: AREG amphiregulin [ Homo sapiens ]
• Official Symbol: AREG
• Synonyms: AREG; amphiregulin; schwannoma derived growth factor , SDGF; schwannoma-derived growth factor; colorectum cell-derived growth factor; AR; SDGF; AREGB; CRDGF; MGC13647
• Gene ID: 374
• mRNA Refseq: NM_001657
• Protein Refseq: NP_001648
• MIM: 104640
• UniProt ID: P15514