Recombinant Human AREG protein, GST-tagged
Cat.No. : | AREG-1221H |
Product Overview : | Recombinant Human AREG protein(25-252 aa), fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 25-252 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH. |
AA Sequence : | AGLDLNDTYSGKREPFSGDHSADGFEVTSRSEMSSGSEISPVSEMPSSSEPSSGADYDYSEEYDNEPQIPGYIVDDSVRVEQVVKPPQNKTESENTSDKPKRKKKGGKNGKNRRNRKKKNPCNAEFQNFCIHGECKYIEHLEAVTCKCQQEYFGERCGEKSMKTHSMIDSSLSKIALAAIAAFMSAVILTAVAVITVQLRRQYVRKYEGEAEERKKLRQENGNVHAIA |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | AREG amphiregulin [ Homo sapiens ] |
Official Symbol | AREG |
Synonyms | AREG; amphiregulin; schwannoma derived growth factor , SDGF; schwannoma-derived growth factor; colorectum cell-derived growth factor; AR; SDGF; AREGB; CRDGF; MGC13647; |
Gene ID | 374 |
mRNA Refseq | NM_001657 |
Protein Refseq | NP_001648 |
MIM | 104640 |
UniProt ID | P15514 |
◆ Recombinant Proteins | ||
RFL-9669RF | Recombinant Full Length Rat Amphiregulin(Areg) Protein, His-Tagged | +Inquiry |
AREG-0293H | Recombinant Human AREG Protein (Ser101-Lys187), N-His-tagged | +Inquiry |
AREG-515C | Recombinant Cattle AREG protein, His & GST-tagged | +Inquiry |
AREG-746R | Recombinant Rat AREG Protein | +Inquiry |
Areg-517R | Recombinant Rat Areg protein, His & T7-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
AREG-8762HCL | Recombinant Human AREG 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All AREG Products
Required fields are marked with *
My Review for All AREG Products
Required fields are marked with *
0
Inquiry Basket