Recombinant Human ARF4 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : ARF4-6329H
Product Overview : ARF4 MS Standard C13 and N15-labeled recombinant protein (NP_001651) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : This gene is a member of the human ARF gene family whose members encode small guanine nucleotide-binding proteins that stimulate the ADP-ribosyltransferase activity of cholera toxin and play a role in vesicular trafficking and as activators of phospholipase D. The gene products include 5 ARF proteins and 11 ARF-like proteins and constitute one family of the RAS superfamily. The ARF proteins are categorized as class I, class II and class III; this gene is a class II member. The members of each class share a common gene organization. The ARF4 gene spans approximately 12kb and contains six exons and five introns. This gene is the most divergent member of the human ARFs. Conflicting map positions at 3p14 or 3p21 have been reported for this gene.
Molecular Mass : 20.5 kDa
AA Sequence : MGLTISSLFSRLFGKKQMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNICFTVWDVGGQDRIRPLWKHYFQNTQGLIFVVDSNDRERIQEVADELQKMLLVDELRDAVLLLFANKQDLPNAMAISEMTDKLGLQSLRNRTWYVQATCATQGTGLYEGLDWLSNELSKRTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name ARF4 ADP-ribosylation factor 4 [ Homo sapiens (human) ]
Official Symbol ARF4
Synonyms ARF4; ADP-ribosylation factor 4; ADP ribosylation factor 2, ARF2; ADP-ribosylation factor 2; ARF2;
Gene ID 378
mRNA Refseq NM_001660
Protein Refseq NP_001651
MIM 601177
UniProt ID P18085

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ARF4 Products

Required fields are marked with *

My Review for All ARF4 Products

Required fields are marked with *

0
cart-icon