Recombinant Human ARF6 protein, His-SUMO-tagged
Cat.No. : | ARF6-2545H |
Product Overview : | Recombinant Human ARF6 protein(P62330)(1-175aa), fused to N-terminal His tag and SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 1-175aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 36.1 kDa |
AA Sequence : | MGKVLSKIFGNKEMRILMLGLDAAGKTTILYKLKLGQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLIFVVDCADRDRIDEARQELHRIINDREMRDAIILIFANKQDLPDAMKPHEIQEKLGLTRIRDRNWYVQPSCATSGDGLYEGLTWLTSNYKS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | ARF6 ADP-ribosylation factor 6 [ Homo sapiens ] |
Official Symbol | ARF6 |
Synonyms | ARF6; ADP-ribosylation factor 6; DKFZp564M0264; |
Gene ID | 382 |
mRNA Refseq | NM_001663 |
Protein Refseq | NP_001654 |
MIM | 600464 |
UniProt ID | P62330 |
◆ Recombinant Proteins | ||
Arf6-638M | Recombinant Mouse Arf6 Protein, MYC/DDK-tagged | +Inquiry |
ARF6-4632H | Recombinant Human ARF6 protein, His-tagged | +Inquiry |
ARF6-369H | Recombinant Human ARF6 Protein, His (Fc)-Avi-tagged | +Inquiry |
Arf6-3210M | Recombinant Mouse Arf6, His-tagged | +Inquiry |
ARF6-1184HF | Recombinant Full Length Human ARF6 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ARF6-8756HCL | Recombinant Human ARF6 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ARF6 Products
Required fields are marked with *
My Review for All ARF6 Products
Required fields are marked with *
0
Inquiry Basket