Recombinant Human ARF6 protein, His-SUMO-tagged
| Cat.No. : | ARF6-2545H |
| Product Overview : | Recombinant Human ARF6 protein(P62330)(1-175aa), fused to N-terminal His tag and SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&SUMO |
| Protein Length : | 1-175aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 36.1 kDa |
| AA Sequence : | MGKVLSKIFGNKEMRILMLGLDAAGKTTILYKLKLGQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLIFVVDCADRDRIDEARQELHRIINDREMRDAIILIFANKQDLPDAMKPHEIQEKLGLTRIRDRNWYVQPSCATSGDGLYEGLTWLTSNYKS |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | ARF6 ADP-ribosylation factor 6 [ Homo sapiens ] |
| Official Symbol | ARF6 |
| Synonyms | ARF6; ADP-ribosylation factor 6; DKFZp564M0264; |
| Gene ID | 382 |
| mRNA Refseq | NM_001663 |
| Protein Refseq | NP_001654 |
| MIM | 600464 |
| UniProt ID | P62330 |
| ◆ Recombinant Proteins | ||
| ARF6-749H | Recombinant Human ARF6 protein, GST-tagged | +Inquiry |
| Arf6-3210M | Recombinant Mouse Arf6, His-tagged | +Inquiry |
| ARF6-3369H | Recombinant Human ADP-ribosylation Factor 6, His-tagged | +Inquiry |
| ARF6-369H | Recombinant Human ARF6 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ARF6-26533TH | Recombinant Human ARF6 protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ARF6-050HKCL | Human ARF6 Knockdown Cell Lysate | +Inquiry |
| ARF6-8756HCL | Recombinant Human ARF6 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ARF6 Products
Required fields are marked with *
My Review for All ARF6 Products
Required fields are marked with *
