Recombinant Human ARFGAP3 protein, GST-tagged
Cat.No. : | ARFGAP3-751H |
Product Overview : | Human ARFGAP3 full-length ORF ( NP_055385.2, 1 a.a. - 516 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The protein encoded by this gene is a GTPase-activating protein (GAP) that associates with the Golgi apparatus and regulates the early secretory pathway of proteins. The encoded protein promotes hydrolysis of ADP-ribosylation factor 1 (ARF1)-bound GTP, which is required for the dissociation of coat proteins from Golgi-derived membranes and vesicles. Dissociation of the coat proteins is a prerequisite for the fusion of these vesicles with target compartments. The activity of this protein is sensitive to phospholipids. Multiple transcript variants encoding different isoforms have been found for this gene. This gene was originally known as ARFGAP1, but that is now the name of a related but different gene. [provided by RefSeq, Nov 2008] |
Molecular Mass : | 83.4 kDa |
AA Sequence : | MGDPSKQDILTIFKRLRSVPTNKVCFDCGAKNPSWASITYGVFLCIDCSGSHRSLGVHLSFIRSTELDSNWSWFQLRCMQVGGNASASSFFHQHGCSTNDTNAKYNSRAAQLYREKIKSLASQATRKHGTDLWLDSCVVPPLSPPPKEEDFFASHVSPEVSDTAWASAIAEPSSLTSRPVETTLENNEGGQEQGPSVEGLNVPTKATLEVSSIIKKKPNQAKKGLGAKKGSLGAQKLANTCFNEIEKQAQAADKMKEQEDLAKVVSKEESIVSSLRLAYKDLEIQMKKDEKMNISGKKNVDSDRLGMGFGNCRSVISHSVTSDMQTIEQESPIMAKPRKKYNDDSDDSYFTSSSRYFDEPVELRSSSFSSWDDSSDSYWKKETSKDTETVLKTTGYSDRPTARRKPDYEPVENTDEAQKKFGNVKAISSDMYFGRQSQADYETRARLERLSASSSISSADLFEEPRKQPAGNYSLSSVLPNAPDMAQFKQGVRSVAGKLSVFANGVVTSIQDRYGS |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ARFGAP3 ADP-ribosylation factor GTPase activating protein 3 [ Homo sapiens ] |
Official Symbol | ARFGAP3 |
Synonyms | ARFGAP3; ADP-ribosylation factor GTPase activating protein 3; ADP ribosylation factor GTPase activating protein 1 , ARFGAP1; ADP-ribosylation factor GTPase-activating protein 3; ARF GAP 3; ADP-ribosylation factor GTPase activating protein 1; ARFGAP1; FLJ45618; |
Gene ID | 26286 |
mRNA Refseq | NM_001142293 |
Protein Refseq | NP_001135765 |
MIM | 612439 |
UniProt ID | Q9NP61 |
◆ Recombinant Proteins | ||
ARFGAP3-9806H | Recombinant Human ARFGAP3, GST-tagged | +Inquiry |
ARFGAP3-382R | Recombinant Rhesus monkey ARFGAP3 Protein, His-tagged | +Inquiry |
ARFGAP3-211R | Recombinant Rhesus Macaque ARFGAP3 Protein, His (Fc)-Avi-tagged | +Inquiry |
ARFGAP3-1197HF | Recombinant Full Length Human ARFGAP3 Protein, GST-tagged | +Inquiry |
ARFGAP3-309C | Recombinant Cynomolgus ARFGAP3 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ARFGAP3-8753HCL | Recombinant Human ARFGAP3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ARFGAP3 Products
Required fields are marked with *
My Review for All ARFGAP3 Products
Required fields are marked with *
0
Inquiry Basket