Recombinant Human ARG1 protein(21-90 aa), C-His-tagged
Cat.No. : | ARG1-2553H |
Product Overview : | Recombinant Human ARG1 protein(P05089)(21-90 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 21-90 aa |
Form : | 0.15 M Phosphate buffered saline |
Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
AA Sequence : | RGGVEEGPTVLRKAGLLEKLKEQECDVKDYGDLPFADIPNDSPFQIVKNPRSVGKASEQLAGKVAEVKKN |
Gene Name | ARG1 arginase, liver [ Homo sapiens ] |
Official Symbol | ARG1 |
Synonyms | ARG1; arginase, liver; arginase-1; type I arginase; liver-type arginase; |
Gene ID | 383 |
mRNA Refseq | NM_000045 |
Protein Refseq | NP_000036 |
MIM | 608313 |
UniProt ID | P05089 |
◆ Recombinant Proteins | ||
ARG1-250HFL | Active Recombinant Full Length Human ARG1 Protein, C-Flag-tagged | +Inquiry |
ARG1-0630H | Recombinant Human ARG1 Protein (Met1-Lys322), N-His-tagged | +Inquiry |
ARG1-2961H | Recombinant Human ARG1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
ARG1-1256H | Active Recombinant Human ARG1 protein, His-tagged | +Inquiry |
ARG1-2553H | Recombinant Human ARG1 protein(21-90 aa), C-His-tagged | +Inquiry |
◆ Native Proteins | ||
Arg1-150R | Active Native Rat Arginase | +Inquiry |
Arg1-8044R | Native Rat Liver Arginase | +Inquiry |
◆ Cell & Tissue Lysates | ||
ARG1-1869HCL | Recombinant Human ARG1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ARG1 Products
Required fields are marked with *
My Review for All ARG1 Products
Required fields are marked with *
0
Inquiry Basket