Recombinant Human ARG1 protein(21-90 aa), C-His-tagged
| Cat.No. : | ARG1-2553H |
| Product Overview : | Recombinant Human ARG1 protein(P05089)(21-90 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 21-90 aa |
| Form : | 0.15 M Phosphate buffered saline |
| Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
| Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
| AA Sequence : | RGGVEEGPTVLRKAGLLEKLKEQECDVKDYGDLPFADIPNDSPFQIVKNPRSVGKASEQLAGKVAEVKKN |
| Gene Name | ARG1 arginase, liver [ Homo sapiens ] |
| Official Symbol | ARG1 |
| Synonyms | ARG1; arginase, liver; arginase-1; type I arginase; liver-type arginase; |
| Gene ID | 383 |
| mRNA Refseq | NM_000045 |
| Protein Refseq | NP_000036 |
| MIM | 608313 |
| UniProt ID | P05089 |
| ◆ Recombinant Proteins | ||
| ARG1-1256H | Active Recombinant Human ARG1 protein, His-tagged | +Inquiry |
| ARG1-3913H | Recombinant Human ARG1 protein, His-tagged | +Inquiry |
| ARG1-4221Z | Recombinant Zebrafish ARG1 | +Inquiry |
| ARG1-2553H | Recombinant Human ARG1 protein(21-90 aa), C-His-tagged | +Inquiry |
| ARG1-756H | Recombinant Human ARG1 protein, GST-tagged | +Inquiry |
| ◆ Native Proteins | ||
| Arg1-8044R | Native Rat Liver Arginase | +Inquiry |
| Arg1-150R | Active Native Rat Arginase | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ARG1-1869HCL | Recombinant Human ARG1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ARG1 Products
Required fields are marked with *
My Review for All ARG1 Products
Required fields are marked with *
