Recombinant Human ARGFX protein, GST-tagged
Cat.No. : | ARGFX-758H |
Product Overview : | Human ARGFX full-length ORF ( NP_001012677.1, 1 a.a. - 315 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | Homeobox genes encode DNA-binding proteins, many of which are thought to be involved in early embryonic development. Homeobox genes encode a DNA-binding domain of 60 to 63 amino acids referred to as the homeodomain. This gene is a member of the ARGFX homeobox gene family. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 62 kDa |
AA Sequence : | MRNRMAPENPQPDPFINRNYSNMKVIPPQDPASPSFTLLSKLECSGTVSAYCSLNLPGSTDPPTSASRVAATTAIRRRHKERTSFTHQQYEELEALFSQTMFPDRNLQEKLALRLDLPESTVKVWFRNRRFKLKKQQQQQSAKQRNQILPSKKNVPTSPRTSPSPYAFSPVISDFYSSLPSQPLDPSNWAWNSTFTESSTSDFQMQDTQWERLVASVPALYSDAYDIFQIIELYNLPDENEISSSSFHCLYQYLSPTKYQVGGQGSSLSIFAGPAVGLSPAQTWPNMTSQAFEAYSLTDSLEFQKTSNMVDLGFL |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ARGFX arginine-fifty homeobox [ Homo sapiens ] |
Official Symbol | ARGFX |
Synonyms | ARGFX; arginine-fifty homeobox; |
Gene ID | 503582 |
mRNA Refseq | NM_001012659 |
Protein Refseq | NP_001012677 |
MIM | 611164 |
UniProt ID | A6NJG6 |
◆ Recombinant Proteins | ||
ARGFX-1322HF | Recombinant Full Length Human ARGFX Protein, GST-tagged | +Inquiry |
ARGFX-3624H | Recombinant Human ARGFX, His-tagged | +Inquiry |
ARGFX-758H | Recombinant Human ARGFX protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ARGFX-107HCL | Recombinant Human ARGFX cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ARGFX Products
Required fields are marked with *
My Review for All ARGFX Products
Required fields are marked with *
0
Inquiry Basket