Recombinant Human ARGLU1 protein, His-tagged
Cat.No. : | ARGLU1-7843H |
Product Overview : | Recombinant Human ARGLU1 protein(63-191 aa), fused with N-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 63-191 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. |
AASequence : | TAVSRRERDRERASSPPDRIDIFGRTVSKRSSLDEKQKREEEEKKAEFERQRKIRQQEIEEKLIEEETARRVEELVAKRVEEELEKRKDEIEREVLRRVEEAKRIMEKQLLEELERQRQAELAAQKARE |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
Gene Name | ARGLU1 arginine and glutamate rich 1 [ Homo sapiens ] |
Official Symbol | ARGLU1 |
Synonyms | ARGLU1; arginine and glutamate rich 1; arginine and glutamate-rich protein 1; FLJ10154; RP11-297I6.1; DKFZp686O08106; |
Gene ID | 55082 |
mRNA Refseq | NM_018011 |
Protein Refseq | NP_060481 |
MIM | 614046 |
UniProt ID | Q9NWB6 |
◆ Recombinant Proteins | ||
ARGLU1-669M | Recombinant Mouse ARGLU1 Protein, His (Fc)-Avi-tagged | +Inquiry |
ARGLU1-386R | Recombinant Rhesus monkey ARGLU1 Protein, His-tagged | +Inquiry |
ARGLU1-1852M | Recombinant Mouse ARGLU1 Protein | +Inquiry |
ARGLU1-761R | Recombinant Rat ARGLU1 Protein | +Inquiry |
ARGLU1-301646H | Recombinant Human ARGLU1 protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ARGLU1-8746HCL | Recombinant Human ARGLU1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ARGLU1 Products
Required fields are marked with *
My Review for All ARGLU1 Products
Required fields are marked with *