Recombinant Human ARHGAP1

• Cat.No.: ARHGAP1-26235TH
• Product Overview: Recombinant fragment of Human ARHGAP1 with a N terminal proprietary tag; Predicted MWt 36.63 kDa.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Protein Length: 100 amino acids
• Molecular Weight: 36.630kDa inclusive of tags
• Tissue specificity: Ubiquitous.
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: GFLNIDESQRVPATLQVLQTLPEENYQVLRFLTAFLVQISAHSDQNKMTNTNLAVVFGPNLLWAKDAAITLKAINPINTFTKFLLDHQGELFPSPDPSGL
• Sequence Similarities: Contains 1 CRAL-TRIO domain.Contains 1 Rho-GAP domain.

Gene Information

• Gene Name: ARHGAP1 Rho GTPase activating protein 1 [ Homo sapiens ]
• Official Symbol: ARHGAP1
• Synonyms: ARHGAP1; Rho GTPase activating protein 1; rho GTPase-activating protein 1; Cdc42GAP; CDC42GAP; p50rhoGAP; RhoGAP
• Gene ID: 392
• mRNA Refseq: NM_004308
• Protein Refseq: NP_004299
• MIM: 602732
• Uniprot ID: Q07960
• Chromosome Location: 11p11.2
• Pathway: Regulation of CDC42 activity, organism-specific biosystem; Regulation of RAC1 activity, organism-specific biosystem; Rho GTPase cycle, organism-specific biosystem; Signal Transduction, organism-specific biosystem; Signaling by Rho GTPases, organism-specific biosystem
• Function: GTPase activator activity; Rac GTPase activator activity; Rho GTPase activator activity; SH3 domain binding; SH3/SH2 adaptor activity