Recombinant Human ARHGAP1
| Cat.No. : | ARHGAP1-26235TH |
| Product Overview : | Recombinant fragment of Human ARHGAP1 with a N terminal proprietary tag; Predicted MWt 36.63 kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | Non |
| Protein Length : | 100 amino acids |
| Molecular Weight : | 36.630kDa inclusive of tags |
| Tissue specificity : | Ubiquitous. |
| Form : | Liquid |
| Purity : | Proprietary Purification |
| Storage buffer : | pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | GFLNIDESQRVPATLQVLQTLPEENYQVLRFLTAFLVQISAHSDQNKMTNTNLAVVFGPNLLWAKDAAITLKAINPINTFTKFLLDHQGELFPSPDPSGL |
| Sequence Similarities : | Contains 1 CRAL-TRIO domain.Contains 1 Rho-GAP domain. |
| Gene Name | ARHGAP1 Rho GTPase activating protein 1 [ Homo sapiens ] |
| Official Symbol | ARHGAP1 |
| Synonyms | ARHGAP1; Rho GTPase activating protein 1; rho GTPase-activating protein 1; Cdc42GAP; CDC42GAP; p50rhoGAP; RhoGAP; |
| Gene ID | 392 |
| mRNA Refseq | NM_004308 |
| Protein Refseq | NP_004299 |
| MIM | 602732 |
| Uniprot ID | Q07960 |
| Chromosome Location | 11p11.2 |
| Pathway | Regulation of CDC42 activity, organism-specific biosystem; Regulation of RAC1 activity, organism-specific biosystem; Rho GTPase cycle, organism-specific biosystem; Signal Transduction, organism-specific biosystem; Signaling by Rho GTPases, organism-specific biosystem; |
| Function | GTPase activator activity; Rac GTPase activator activity; Rho GTPase activator activity; SH3 domain binding; SH3/SH2 adaptor activity; |
| ◆ Recombinant Proteins | ||
| ARHGAP1-373H | Recombinant Human ARHGAP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ARHGAP1-2523Z | Recombinant Zebrafish ARHGAP1 | +Inquiry |
| ARHGAP1-9812H | Recombinant Human ARHGAP1, GST-tagged | +Inquiry |
| ARHGAP1-37H | Active Recombinant Human ARHGAP1 Protein (Full Length), N-His tagged | +Inquiry |
| ARHGAP1-216R | Recombinant Rhesus Macaque ARHGAP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ARHGAP1-8745HCL | Recombinant Human ARHGAP1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ARHGAP1 Products
Required fields are marked with *
My Review for All ARHGAP1 Products
Required fields are marked with *
