Recombinant Human ARHGAP26 Protein, His-tagged

• Cat.No.: ARHGAP26-27H
• Product Overview: Recombinant Human ARHGAP26 Protein(Q9UNA1)(Leu581-Arg700), fused with C-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: Leu581-Arg700
• Form: Phosphate buffered saline
• Storage: Store at -20 to -80°C.
• Molecular Mass: 15 kDa
• AA Sequence: LHLSRKKSSDSKPPSCSERPLTLFHTVQSTEKQEQRNSIINSSLESVSSNPNSILNSSSSLQPNMNSSDPDLAVVKPTRPNSLPPNPSPTSPLSPSWPMFSAPSSPMPTSSTSSDSSPVR

Gene Information

• Official Symbol: ARHGAP26
• Synonyms: ARHGAP26; Rho GTPase activating protein 26; rho GTPase-activating protein 26; GRAF; GTPase regulator associated with the focal adhesion kinase pp125; KIAA0621; OPHN1L; OPHN1L1; oligophrenin-1-like protein; GTPase regulator associated with focal adhesion kinase pp125(FAK); GRAF1; FLJ42530
• Gene ID: 23092
• mRNA Refseq: NM_001135608
• Protein Refseq: NP_001129080
• MIM: 605370
• UniProt ID: Q9UNA1