Recombinant Human ARHGAP26 Protein, His-tagged
Cat.No. : | ARHGAP26-27H |
Product Overview : | Recombinant Human ARHGAP26 Protein(Q9UNA1)(Leu581-Arg700), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | Leu581-Arg700 |
Form : | Phosphate buffered saline |
Storage : | Store at -20 to -80°C. |
Molecular Mass : | 15 kDa |
AA Sequence : | LHLSRKKSSDSKPPSCSERPLTLFHTVQSTEKQEQRNSIINSSLESVSSNPNSILNSSSSLQPNMNSSDPDLAVVKPTRPNSLPPNPSPTSPLSPSWPMFSAPSSPMPTSSTSSDSSPVR |
Official Symbol | ARHGAP26 |
Synonyms | ARHGAP26; Rho GTPase activating protein 26; rho GTPase-activating protein 26; GRAF; GTPase regulator associated with the focal adhesion kinase pp125; KIAA0621; OPHN1L; OPHN1L1; oligophrenin-1-like protein; GTPase regulator associated with focal adhesion kinase pp125(FAK); GRAF1; FLJ42530; |
Gene ID | 23092 |
mRNA Refseq | NM_001135608 |
Protein Refseq | NP_001129080 |
MIM | 605370 |
UniProt ID | Q9UNA1 |
◆ Recombinant Proteins | ||
ARHGAP26-1145H | Recombinant Human ARHGAP26 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
ARHGAP26-2514H | Recombinant Human ARHGAP26 Protein, MYC/DDK-tagged | +Inquiry |
ARHGAP26-767H | Recombinant Human ARHGAP26 protein, GST-tagged | +Inquiry |
ARHGAP26-6748C | Recombinant Chicken ARHGAP26 | +Inquiry |
ARHGAP26-27H | Recombinant Human ARHGAP26 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ARHGAP26-111HCL | Recombinant Human ARHGAP26 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ARHGAP26 Products
Required fields are marked with *
My Review for All ARHGAP26 Products
Required fields are marked with *