Recombinant Human ARHGAP26 Protein, His-tagged

Cat.No. : ARHGAP26-27H
Product Overview : Recombinant Human ARHGAP26 Protein(Q9UNA1)(Leu581-Arg700), fused with C-terminal His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : Leu581-Arg700
Form : Phosphate buffered saline
Storage : Store at -20 to -80°C.
Molecular Mass : 15 kDa
AA Sequence : LHLSRKKSSDSKPPSCSERPLTLFHTVQSTEKQEQRNSIINSSLESVSSNPNSILNSSSSLQPNMNSSDPDLAVVKPTRPNSLPPNPSPTSPLSPSWPMFSAPSSPMPTSSTSSDSSPVR
Official Symbol ARHGAP26
Synonyms ARHGAP26; Rho GTPase activating protein 26; rho GTPase-activating protein 26; GRAF; GTPase regulator associated with the focal adhesion kinase pp125; KIAA0621; OPHN1L; OPHN1L1; oligophrenin-1-like protein; GTPase regulator associated with focal adhesion kinase pp125(FAK); GRAF1; FLJ42530;
Gene ID 23092
mRNA Refseq NM_001135608
Protein Refseq NP_001129080
MIM 605370
UniProt ID Q9UNA1

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ARHGAP26 Products

Required fields are marked with *

My Review for All ARHGAP26 Products

Required fields are marked with *

0
cart-icon