Recombinant Human ARHGAP29 protein, GST-tagged
| Cat.No. : | ARHGAP29-769H |
| Product Overview : | Human ARHGAP29 partial ORF ( AAH93767.1, 12 a.a. - 111 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | Rap1 is a small GTPase that, through effectors, regulates Rho GTPase signaling. These effectors- Rasip1, Radil, and the protein encoded by this gene- translocate to the cell membrane, where they form a multiprotein complex. This complex is necessary for Rap1-induced inhibition of Rho signaling. Defects in this gene may be a cause of nonsyndromic cleft lip with or without cleft palate. [provided by RefSeq, Jun 2016] |
| Molecular Mass : | 36.74 kDa |
| AA Sequence : | KRAWASGQLSTDITTSEMGLKSLSSNSIFDPDYIKELVNDIRKFSHMLLYLKEAIFSDCFKEVIHIRLEELLRVLKSIMNKHQNLNSVDLQNAAEMLTAK |
| Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | ARHGAP29 Rho GTPase activating protein 29 [ Homo sapiens ] |
| Official Symbol | ARHGAP29 |
| Synonyms | ARHGAP29; Rho GTPase activating protein 29; rho GTPase-activating protein 29; PARG1; PTPL1-associated RhoGAP 1 (PARG1); PTPL1-associated RhoGAP protein 1; rho-type GTPase-activating protein 29; RP11-255E17.1; |
| Gene ID | 9411 |
| mRNA Refseq | NM_004815 |
| Protein Refseq | NP_004806 |
| MIM | 610496 |
| UniProt ID | Q52LW3 |
| ◆ Recombinant Proteins | ||
| ARHGAP29-194H | Recombinant Human ARHGAP29 Protein, MYC/DDK-tagged, C13 and N15-labeled | +Inquiry |
| ARHGAP29-9825H | Recombinant Human ARHGAP29, GST-tagged | +Inquiry |
| ARHGAP29-1868M | Recombinant Mouse ARHGAP29 Protein | +Inquiry |
| ARHGAP29-678M | Recombinant Mouse ARHGAP29 Protein, His (Fc)-Avi-tagged | +Inquiry |
| Arhgap29-246M | Recombinant Mouse Arhgap29 Protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ARHGAP29-8739HCL | Recombinant Human ARHGAP29 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ARHGAP29 Products
Required fields are marked with *
My Review for All ARHGAP29 Products
Required fields are marked with *



