Recombinant Human ARHGAP29 protein, GST-tagged
Cat.No. : | ARHGAP29-769H |
Product Overview : | Human ARHGAP29 partial ORF ( AAH93767.1, 12 a.a. - 111 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | Rap1 is a small GTPase that, through effectors, regulates Rho GTPase signaling. These effectors- Rasip1, Radil, and the protein encoded by this gene- translocate to the cell membrane, where they form a multiprotein complex. This complex is necessary for Rap1-induced inhibition of Rho signaling. Defects in this gene may be a cause of nonsyndromic cleft lip with or without cleft palate. [provided by RefSeq, Jun 2016] |
Molecular Mass : | 36.74 kDa |
AA Sequence : | KRAWASGQLSTDITTSEMGLKSLSSNSIFDPDYIKELVNDIRKFSHMLLYLKEAIFSDCFKEVIHIRLEELLRVLKSIMNKHQNLNSVDLQNAAEMLTAK |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ARHGAP29 Rho GTPase activating protein 29 [ Homo sapiens ] |
Official Symbol | ARHGAP29 |
Synonyms | ARHGAP29; Rho GTPase activating protein 29; rho GTPase-activating protein 29; PARG1; PTPL1-associated RhoGAP 1 (PARG1); PTPL1-associated RhoGAP protein 1; rho-type GTPase-activating protein 29; RP11-255E17.1; |
Gene ID | 9411 |
mRNA Refseq | NM_004815 |
Protein Refseq | NP_004806 |
MIM | 610496 |
UniProt ID | Q52LW3 |
◆ Recombinant Proteins | ||
Arhgap29-246M | Recombinant Mouse Arhgap29 Protein, His-tagged | +Inquiry |
ARHGAP29-2492H | Recombinant Human ARHGAP29 Protein, His (Fc)-Avi-tagged | +Inquiry |
ARHGAP29-4520C | Recombinant Chicken ARHGAP29 | +Inquiry |
Arhgap29-1686M | Recombinant Mouse Arhgap29 Protein, Myc/DDK-tagged | +Inquiry |
ARHGAP29-194H | Recombinant Human ARHGAP29 Protein, MYC/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
ARHGAP29-8739HCL | Recombinant Human ARHGAP29 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ARHGAP29 Products
Required fields are marked with *
My Review for All ARHGAP29 Products
Required fields are marked with *
0
Inquiry Basket