Recombinant Human ARHGDIA, His-tagged
Cat.No. : | ARHGDIA-30981TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 6-204 of Human RhoGDI with an N terminal His tag; MWt 25kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 6-204 a.a. |
Description : | Aplysia Ras-related homologs (ARHs), also called Rho genes, belong to the RAS gene superfamily encoding small guanine nucleotide exchange (GTP/GDP) factors. The ARH proteins may be kept in the inactive, GDP-bound state by interaction with GDP dissociation inhibitors, such as ARHGDIA (Leffers et al. |
Conjugation : | HIS |
Form : | Lyophilised:Reconstitute with 156 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | PTAEQLAQIAAENEEDEHSVNYKPPAQKSIQEIQELDKDD ESLRKYKEALLGRVAVSADPNVPNVVVTGLTLVCSSAP GPLELDLTGDLESFKKQSFVLKEGVEYRIKISFRVNRE IVSGMKYIQHTYRKGVKIDKTDYMVGSYGPRAEEYEFL TPVEEAPKGMLARGSYSIKSRFTDDDKTDHLSWEWNLTIK KDWKD |
Sequence Similarities : | Belongs to the Rho GDI family. |
Gene Name | ARHGDIA Rho GDP dissociation inhibitor (GDI) alpha [ Homo sapiens ] |
Official Symbol | ARHGDIA |
Synonyms | ARHGDIA; Rho GDP dissociation inhibitor (GDI) alpha; GDIA1; rho GDP-dissociation inhibitor 1; RHOGDI; |
Gene ID | 396 |
mRNA Refseq | NM_001185077 |
Protein Refseq | NP_001172006 |
MIM | 601925 |
Uniprot ID | P52565 |
Chromosome Location | 17q25.3 |
Pathway | Axonal growth inhibition (RHOA activation), organism-specific biosystem; Axonal growth stimulation, organism-specific biosystem; CDC42 signaling events, organism-specific biosystem; Neurotrophin signaling pathway, organism-specific biosystem; Neurotrophin signaling pathway, conserved biosystem; |
Function | GTPase activator activity; Rho GDP-dissociation inhibitor activity; |
◆ Recombinant Proteins | ||
ARHGDIA-6906H | Recombinant Human Rho GDP Dissociation Inhibitor (GDI) Alpha, His-tagged | +Inquiry |
ARHGDIA-4913H | Recombinant Human Rho GDP Dissociation Inhibitor (GDI) Alpha | +Inquiry |
ARHGDIA-424R | Recombinant Rat ARHGDIA Protein, His (Fc)-Avi-tagged | +Inquiry |
ARHGDIA-1883M | Recombinant Mouse ARHGDIA Protein | +Inquiry |
ARHGDIA-60C | Recombinant Cynomolgus Monkey ARHGDIA Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ARHGDIA-8736HCL | Recombinant Human ARHGDIA 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ARHGDIA Products
Required fields are marked with *
My Review for All ARHGDIA Products
Required fields are marked with *