Recombinant Human ARHGDIA protein, GST-tagged

Cat.No. : ARHGDIA-774H
Product Overview : Human ARHGDIA full-length ORF ( AAH16031, 1 a.a. - 204 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a protein that plays a key role in the regulation of signaling through Rho GTPases. The encoded protein inhibits the disassociation of Rho family members from GDP (guanine diphosphate), thereby maintaining these factors in an inactive state. Activity of this protein is important in a variety of cellular processes, and expression of this gene may be altered in tumors. Mutations in this gene have been found in individuals with nephrotic syndrome, type 8. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Jul 2014]
Molecular Mass : 48.18 kDa
AA Sequence : MAEQEPTAEQLAQIAAENEEDEHSVNYKPPAQKSIQEIQELDKDDESLRKYKEALLGRVAVSADPNVPNVVVTGLTLVCSSAPGPLELDLTGDLESFKKQSFVLKEGVEYRIKISFRVNREIVSGMKYIQHTYRKGVKIDKTDYMVGSYGPRAEEYEFLTPVEEAPKGMLARGSYSIKSRFTDDDKTDHLSWEWNLTIKKDWKD
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ARHGDIA Rho GDP dissociation inhibitor (GDI) alpha [ Homo sapiens ]
Official Symbol ARHGDIA
Synonyms ARHGDIA; Rho GDP dissociation inhibitor (GDI) alpha; GDIA1; rho GDP-dissociation inhibitor 1; RHOGDI; rho GDI 1; rho-GDI alpha; RHOGDI-1; MGC117248;
Gene ID 396
mRNA Refseq NM_001185077
Protein Refseq NP_001172006
MIM 601925
UniProt ID P52565

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ARHGDIA Products

Required fields are marked with *

My Review for All ARHGDIA Products

Required fields are marked with *

0
cart-icon
0
compare icon