Recombinant Human ARHGDIA protein, GST-tagged
Cat.No. : | ARHGDIA-774H |
Product Overview : | Human ARHGDIA full-length ORF ( AAH16031, 1 a.a. - 204 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a protein that plays a key role in the regulation of signaling through Rho GTPases. The encoded protein inhibits the disassociation of Rho family members from GDP (guanine diphosphate), thereby maintaining these factors in an inactive state. Activity of this protein is important in a variety of cellular processes, and expression of this gene may be altered in tumors. Mutations in this gene have been found in individuals with nephrotic syndrome, type 8. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Jul 2014] |
Molecular Mass : | 48.18 kDa |
AA Sequence : | MAEQEPTAEQLAQIAAENEEDEHSVNYKPPAQKSIQEIQELDKDDESLRKYKEALLGRVAVSADPNVPNVVVTGLTLVCSSAPGPLELDLTGDLESFKKQSFVLKEGVEYRIKISFRVNREIVSGMKYIQHTYRKGVKIDKTDYMVGSYGPRAEEYEFLTPVEEAPKGMLARGSYSIKSRFTDDDKTDHLSWEWNLTIKKDWKD |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ARHGDIA Rho GDP dissociation inhibitor (GDI) alpha [ Homo sapiens ] |
Official Symbol | ARHGDIA |
Synonyms | ARHGDIA; Rho GDP dissociation inhibitor (GDI) alpha; GDIA1; rho GDP-dissociation inhibitor 1; RHOGDI; rho GDI 1; rho-GDI alpha; RHOGDI-1; MGC117248; |
Gene ID | 396 |
mRNA Refseq | NM_001185077 |
Protein Refseq | NP_001172006 |
MIM | 601925 |
UniProt ID | P52565 |
◆ Recombinant Proteins | ||
ARHGDIA-2880H | Recombinant Human ARHGDIA, His-tagged | +Inquiry |
ARHGDIA-12629Z | Recombinant Zebrafish ARHGDIA | +Inquiry |
ARHGDIA-774H | Recombinant Human ARHGDIA protein, GST-tagged | +Inquiry |
ARHGDIA-30981TH | Recombinant Human ARHGDIA, His-tagged | +Inquiry |
ARHGDIA-5136H | Recombinant Human ARHGDIA protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ARHGDIA-8736HCL | Recombinant Human ARHGDIA 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ARHGDIA Products
Required fields are marked with *
My Review for All ARHGDIA Products
Required fields are marked with *
0
Inquiry Basket