Recombinant Human ARHGDIA protein, GST-tagged
| Cat.No. : | ARHGDIA-30124H |
| Product Overview : | Recombinant Human ARHGDIA (1-204 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | Met1-Asp204 |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
| AA Sequence : | MAEQEPTAEQLAQIAAENEEDEHSVNYKPPAQKSIQEIQELDKDDESLRKYKEALLGRVAVSADPNVPNVVVTGLTLVCSSAPGPLELDLTGDLESFKKQSFVLKEGVEYRIKISFRVNREIVSGMKYIQHTYRKGVKIDKTDYMVGSYGPRAEEYEFLTPVEEAPKGMLARGSYSIKSRFTDDDKTDHLSWEWNLTIKKDWKD |
| Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | ARHGDIA Rho GDP dissociation inhibitor alpha [ Homo sapiens (human) ] |
| Official Symbol | ARHGDIA |
| Synonyms | ARHGDIA; GDIA1; NPHS8; RHOGDI; RHOGDI-1; HEL-S-47e |
| Gene ID | 396 |
| mRNA Refseq | NM_001185077 |
| Protein Refseq | NP_001172006 |
| MIM | 601925 |
| UniProt ID | P52565 |
| ◆ Recombinant Proteins | ||
| ARHGDIA-424R | Recombinant Rat ARHGDIA Protein, His (Fc)-Avi-tagged | +Inquiry |
| ARHGDIA-310C | Recombinant Cynomolgus ARHGDIA Protein, His-tagged | +Inquiry |
| Arhgdia-1689M | Recombinant Mouse Arhgdia Protein, Myc/DDK-tagged | +Inquiry |
| ARHGDIA-60C | Recombinant Cynomolgus Monkey ARHGDIA Protein, His (Fc)-Avi-tagged | +Inquiry |
| ARHGDIA-30981TH | Recombinant Human ARHGDIA, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ARHGDIA-8736HCL | Recombinant Human ARHGDIA 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ARHGDIA Products
Required fields are marked with *
My Review for All ARHGDIA Products
Required fields are marked with *
