Recombinant Human ARHGEF26 protein, GST-tagged
Cat.No. : | ARHGEF26-4343H |
Product Overview : | Recombinant Human ARHGEF26 protein(131-259 aa), fused with N-terminal GST tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 131-259 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH). |
AASequence : | YNVNDYSLRDQLLVESCDNEELNSSPGKNSSTMLYSRQSSASHLFTLTVLSNHANEKVEMLLGAETQSERARWITALGHSSGKPPADRTSLTQVEIVRSFTAKQPDELSLQVADVVLIYQRVSDGWYEG |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
Gene Name | ARHGEF26 Rho guanine nucleotide exchange factor (GEF) 26 [ Homo sapiens ] |
Official Symbol | ARHGEF26 |
Synonyms | ARHGEF26; Rho guanine nucleotide exchange factor (GEF) 26; rho guanine nucleotide exchange factor 26; DKFZP434D146; SGEF; Src homology 3 domain containing guanine nucleotide exchange factor; SH3 domain-containing guanine exchange factor; Src homology 3 domain-containing guanine nucleotide exchange factor; CSGEF; HMFN1864; DKFZp434D146; |
Gene ID | 26084 |
mRNA Refseq | NM_001251962 |
Protein Refseq | NP_001238891 |
UniProt ID | Q96DR7 |
◆ Recombinant Proteins | ||
ARHGEF26-4343H | Recombinant Human ARHGEF26 protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ARHGEF26 Products
Required fields are marked with *
My Review for All ARHGEF26 Products
Required fields are marked with *