Recombinant Human ARID1A Protein (1976-2231 aa), His-Myc-tagged
Cat.No. : | ARID1A-2488H |
Product Overview : | Recombinant Human ARID1A Protein (1976-2231 aa) is produced by E. coli expression system. This protein is fused with a 10xHis tag at the N-terminal and a Myc tag at the C-terminal. Research Area: Cancer. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&Myc |
Protein Length : | 1976-2231 aa |
Description : | Involved in transcriptional activation and repression of select genes by chromatin remodeling (alteration of DNA-nucleosome topology). Binds DNA non-specifically. Belongs to the neural progenitors-specific chromatin remodeling complex (npBAF complex) and the neuron-specific chromatin remodeling complex (nBAF complex). During neural development a switch from a stem/progenitor to a post-mitotic chromatin remodeling mechanism occurs as neurons exit the cell cycle and become committed to their adult state. The transition from proliferating neural stem/progenitor cells to post-mitotic neurons requires a switch in subunit composition of the npBAF and nBAF complexes. As neural progenitors exit mitosis and differentiate into neurons, npBAF complexes which contain ACTL6A/BAF53A and PHF10/BAF45A, are exchanged for homologous alternative ACTL6B/BAF53B and DPF1/BAF45B or DPF3/BAF45C subunits in neuron-specific complexes (nBAF). The npBAF complex is essential for the self-renewal/proliferative capacity of the multipotent neural stem cells. The nBAF complex along with CREST plays a role regulating the activity of genes essential for dendrite growth. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 33.4 kDa |
AA Sequence : | SLAKRCVCVSNTIRSLSFVPGNDFEMSKHPGLLLILGKLILLHHKHPERKQAPLTYEKEEEQDQGVSCNKVEWWWDCLEMLRENTLVTLANISGQLDLSPYPESICLPVLDGLLHWAVCPSAEAQDPFSTLGPNAVLSPQRLVLETLSKLSIQDNNVDLILATPPFSRLEKLYSTMVRFLSDRKNPVCREMAVVLLANLAQGDSLAARAIAVQKGSIGNLLGFLEDSLAATQFQQSQASLLHMQNPPFEPTSVDMM |
Purity : | > 85% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA will be sent along with the products. Please refer to it for detailed information. |
Gene Name | ARID1A AT rich interactive domain 1A (SWI-like) [ Homo sapiens ] |
Official Symbol | ARID1A |
Synonyms | ARID1A; B120; BAF250; BAF250a; C10rf4; P270; osa homolog 1; SWI-like protein; ELD; OSA1; hELD; BM029; hOSA1; C1orf4; SMARCF1; |
Gene ID | 8289 |
mRNA Refseq | NM_006015 |
Protein Refseq | NP_006006 |
MIM | 603024 |
UniProt ID | O14497 |
◆ Recombinant Proteins | ||
ARID1A-705M | Recombinant Mouse ARID1A Protein, His (Fc)-Avi-tagged | +Inquiry |
ARID1A-2549H | Recombinant Human ARID1A protein, His&Myc-tagged | +Inquiry |
ARID1A-1909M | Recombinant Mouse ARID1A Protein | +Inquiry |
ARID1A-2201H | Recombinant Human ARID1A protein, His&Myc-tagged | +Inquiry |
Arid1a-3676M | Recombinant Mouse Arid1a, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ARID1A Products
Required fields are marked with *
My Review for All ARID1A Products
Required fields are marked with *
0
Inquiry Basket