Recombinant Human ARID1A protein, His&Myc-tagged
Cat.No. : | ARID1A-2201H |
Product Overview : | Recombinant Human ARID1A protein(O14497)(1976-2231aa), fused to N-terminal His tag and C-terminal Myc tag, was expressed in Insect Cell. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Insect Cells |
Tag : | His&Myc |
Protein Length : | 1976-2231aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 32.4 kDa |
AA Sequence : | SLAKRCVCVSNTIRSLSFVPGNDFEMSKHPGLLLILGKLILLHHKHPERKQAPLTYEKEEEQDQGVSCNKVEWWWDCLEMLRENTLVTLANISGQLDLSPYPESICLPVLDGLLHWAVCPSAEAQDPFSTLGPNAVLSPQRLVLETLSKLSIQDNNVDLILATPPFSRLEKLYSTMVRFLSDRKNPVCREMAVVLLANLAQGDSLAARAIAVQKGSIGNLLGFLEDSLAATQFQQSQASLLHMQNPPFEPTSVDMM |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ARID1A AT rich interactive domain 1A (SWI-like) [ Homo sapiens ] |
Official Symbol | ARID1A |
Synonyms | ARID1A; AT rich interactive domain 1A (SWI-like); AT rich interactive domain 1A (SWI like) , C1orf4, SMARCF1, SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily f, member 1; AT-rich interactive domain-containing protein 1A; B120; BAF250; BAF250a; C10rf4; P270; osa homolog 1; SWI-like protein; brain protein 120; OSA1 nuclear protein; BRG1-associated factor 250a; SWI/SNF complex protein p270; chromatin remodeling factor p250; ARID domain-containing protein 1A; SWI/SNF-related, matrix-associated, actin-dependent regulator of chromatin subfamily F member 1; ELD; OSA1; hELD; BM029; hOSA1; C1orf4; SMARCF1; |
Gene ID | 8289 |
mRNA Refseq | NM_006015 |
Protein Refseq | NP_006006 |
MIM | 603024 |
UniProt ID | O14497 |
◆ Recombinant Proteins | ||
Arid1a-3676M | Recombinant Mouse Arid1a, His-tagged | +Inquiry |
ARID1A-705M | Recombinant Mouse ARID1A Protein, His (Fc)-Avi-tagged | +Inquiry |
ARID1A-1909M | Recombinant Mouse ARID1A Protein | +Inquiry |
ARID1A-2549H | Recombinant Human ARID1A protein, His&Myc-tagged | +Inquiry |
ARID1A-2201H | Recombinant Human ARID1A protein, His&Myc-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ARID1A Products
Required fields are marked with *
My Review for All ARID1A Products
Required fields are marked with *
0
Inquiry Basket