Recombinant Human ARID1B protein, GST-tagged

• Cat.No.: ARID1B-793H
• Product Overview: Human ARID1B partial ORF ( NP_059989, 1364 a.a. - 1460 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This locus encodes an AT-rich DNA interacting domain-containing protein. The encoded protein is a component of the SWI/SNF chromatin remodeling complex and may play a role in cell-cycle activation. The protein encoded by this locus is similar to AT-rich interactive domain-containing protein 1A. These two proteins function as alternative, mutually exclusive ARID-subunits of the SWI/SNF complex. The associated complexes play opposing roles. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Oct 2016]
• Molecular Mass: 36.41 kDa
• AA Sequence: PPAKRHEGDMYNMQYSSQQQEMYNQYGGSYSGPDRRPIQGQYPYPYSRERMQGPGQIQTHGIPPQMMGGPLQSSSSEGPQQNMWAARNDMPYPYQNR
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: ARID1B AT rich interactive domain 1B (SWI1-like) [ Homo sapiens ]
• Official Symbol: ARID1B
• Synonyms: ARID1B; AT rich interactive domain 1B (SWI1-like); AT-rich interactive domain-containing protein 1B; 6A3 5; BAF250b; DAN15; ELD/OSA1; KIAA1235; p250R; ELD (eyelid)/OSA protein; BRG1-associated factor 250b; BRG1-binding protein ELD/OSA1; ARID domain-containing protein 1B; OSA2; 6A3-5; MRD12; P250R; BRIGHT; BAF250B
• Gene ID: 57492
• mRNA Refseq: NM_017519
• Protein Refseq: NP_059989
• MIM: 614556
• UniProt ID: Q8NFD5