Recombinant Human ARID1B protein, GST-tagged

Cat.No. : ARID1B-793H
Product Overview : Human ARID1B partial ORF ( NP_059989, 1364 a.a. - 1460 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This locus encodes an AT-rich DNA interacting domain-containing protein. The encoded protein is a component of the SWI/SNF chromatin remodeling complex and may play a role in cell-cycle activation. The protein encoded by this locus is similar to AT-rich interactive domain-containing protein 1A. These two proteins function as alternative, mutually exclusive ARID-subunits of the SWI/SNF complex. The associated complexes play opposing roles. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Oct 2016]
Molecular Mass : 36.41 kDa
AA Sequence : PPAKRHEGDMYNMQYSSQQQEMYNQYGGSYSGPDRRPIQGQYPYPYSRERMQGPGQIQTHGIPPQMMGGPLQSSSSEGPQQNMWAARNDMPYPYQNR
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ARID1B AT rich interactive domain 1B (SWI1-like) [ Homo sapiens ]
Official Symbol ARID1B
Synonyms ARID1B; AT rich interactive domain 1B (SWI1-like); AT-rich interactive domain-containing protein 1B; 6A3 5; BAF250b; DAN15; ELD/OSA1; KIAA1235; p250R; ELD (eyelid)/OSA protein; BRG1-associated factor 250b; BRG1-binding protein ELD/OSA1; ARID domain-containing protein 1B; OSA2; 6A3-5; MRD12; P250R; BRIGHT; BAF250B;
Gene ID 57492
mRNA Refseq NM_017519
Protein Refseq NP_059989
MIM 614556
UniProt ID Q8NFD5

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ARID1B Products

Required fields are marked with *

My Review for All ARID1B Products

Required fields are marked with *

0

Inquiry Basket

cartIcon