Recombinant Human ARL1 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: ARL1-4774H
• Product Overview: ARL1 MS Standard C13 and N15-labeled recombinant protein (NP_001168) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: The protein encoded by this gene belongs to the ARL (ADP-ribosylation factor-like) family of proteins, which are structurally related to ADP-ribosylation factors (ARFs). ARFs, described as activators of cholera toxin (CT) ADP-ribosyltransferase activity, regulate intracellular vesicular membrane trafficking, and stimulate a phospholipase D (PLD) isoform. Although, ARL proteins were initially thought not to activate CT or PLD, later work showed that they are weak stimulators of PLD and CT in a phospholipid dependent manner. Alternative splicing results in multiple transcript variants encoding different isoforms.
• Molecular Mass: 20.4 kDa
• AA Sequence: MGGFFSSIFSSLFGTREMRILILGLDGAGKTTILYRLQVGEVVTTIPTIGFNVETVTYKNLKFQVWDLGGQTSIRPYWRCYYSNTDAVIYVVDSCDRDRIGISKSELVAMLEEEELRKAILVVFANKQDMEQAMTSSEMANSLGLPALKDRKWQIFKTSATKGTGLDEAMEWLVETLKSRQTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: ARL1 ADP-ribosylation factor-like 1 [ Homo sapiens (human) ]
• Official Symbol: ARL1
• Synonyms: ARL1; ADP-ribosylation factor-like 1; ADP-ribosylation factor-like protein 1; ARFL1
• Gene ID: 400
• mRNA Refseq: NM_001177
• Protein Refseq: NP_001168
• MIM: 603425
• UniProt ID: P40616