Recombinant Human ARL1 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | ARL1-4774H |
Product Overview : | ARL1 MS Standard C13 and N15-labeled recombinant protein (NP_001168) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | The protein encoded by this gene belongs to the ARL (ADP-ribosylation factor-like) family of proteins, which are structurally related to ADP-ribosylation factors (ARFs). ARFs, described as activators of cholera toxin (CT) ADP-ribosyltransferase activity, regulate intracellular vesicular membrane trafficking, and stimulate a phospholipase D (PLD) isoform. Although, ARL proteins were initially thought not to activate CT or PLD, later work showed that they are weak stimulators of PLD and CT in a phospholipid dependent manner. Alternative splicing results in multiple transcript variants encoding different isoforms. |
Molecular Mass : | 20.4 kDa |
AA Sequence : | MGGFFSSIFSSLFGTREMRILILGLDGAGKTTILYRLQVGEVVTTIPTIGFNVETVTYKNLKFQVWDLGGQTSIRPYWRCYYSNTDAVIYVVDSCDRDRIGISKSELVAMLEEEELRKAILVVFANKQDMEQAMTSSEMANSLGLPALKDRKWQIFKTSATKGTGLDEAMEWLVETLKSRQTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | ARL1 ADP-ribosylation factor-like 1 [ Homo sapiens (human) ] |
Official Symbol | ARL1 |
Synonyms | ARL1; ADP-ribosylation factor-like 1; ADP-ribosylation factor-like protein 1; ARFL1; |
Gene ID | 400 |
mRNA Refseq | NM_001177 |
Protein Refseq | NP_001168 |
MIM | 603425 |
UniProt ID | P40616 |
◆ Recombinant Proteins | ||
Arl1-3211R | Recombinant Rat Arl1, His-tagged | +Inquiry |
ARL1-4200H | Recombinant Human ADP-Ribosylation Factor-Like 1, His-tagged | +Inquiry |
ARL1-3651C | Recombinant Chicken ARL1 | +Inquiry |
ARL1-432R | Recombinant Rat ARL1 Protein, His (Fc)-Avi-tagged | +Inquiry |
ARL1-603Z | Recombinant Zebrafish ARL1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
ARL1-8724HCL | Recombinant Human ARL1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ARL1 Products
Required fields are marked with *
My Review for All ARL1 Products
Required fields are marked with *
0
Inquiry Basket