Recombinant Human ARL10 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | ARL10-2480H |
Product Overview : | ARL10 MS Standard C13 and N15-labeled recombinant protein (NP_775935) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | ARL10 (ADP Ribosylation Factor Like GTPase 10) is a Protein Coding gene. Diseases associated with ARL10 include Martsolf Syndrome. Gene Ontology (GO) annotations related to this gene include GTP binding. An important paralog of this gene is ARL9. |
Molecular Mass : | 27.3 kDa |
AA Sequence : | MAPRPLGPLVLALGGAAAVLGSVLFILWKTYFGRGRERRWDRGEAWWGAEAARLPEWDEWDPEDEEDEEPALEELEQREVLVLGLDGAGKSTFLRVLSGKPPLEGHIPTWGFNSVRLPTKDFEVDLLEIGGSQNLRFYWKEFVSEVDVLVFVVDSADRLRLPWARQELHKLLDKDPDLPVVVVANKQDLSEAMSMGELQRELGLQAIDNQREVFLLAASIAPAGPTFEEPGTVHIWKLLLELLSTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | ARL10 ADP-ribosylation factor-like 10 [ Homo sapiens (human) ] |
Official Symbol | ARL10 |
Synonyms | ARL10; ADP-ribosylation factor-like 10; ADP ribosylation factor like 10A, ARL10A; ADP-ribosylation factor-like protein 10; ADP-ribosylation factor-like 10A; ADP-ribosylation factor-like membrane-associated protein; ARL10A; FLJ39249; |
Gene ID | 285598 |
mRNA Refseq | NM_173664 |
Protein Refseq | NP_775935 |
UniProt ID | Q8N8L6 |
◆ Recombinant Proteins | ||
Arl10-1701M | Recombinant Mouse Arl10 Protein, Myc/DDK-tagged | +Inquiry |
ARL10-715M | Recombinant Mouse ARL10 Protein, His (Fc)-Avi-tagged | +Inquiry |
ARL10-1921M | Recombinant Mouse ARL10 Protein | +Inquiry |
ARL10-225R | Recombinant Rhesus Macaque ARL10 Protein, His (Fc)-Avi-tagged | +Inquiry |
ARL10-2480H | Recombinant Human ARL10 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
ARL10-8723HCL | Recombinant Human ARL10 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ARL10 Products
Required fields are marked with *
My Review for All ARL10 Products
Required fields are marked with *