Recombinant Human ARL10 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : ARL10-2480H
Product Overview : ARL10 MS Standard C13 and N15-labeled recombinant protein (NP_775935) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : ARL10 (ADP Ribosylation Factor Like GTPase 10) is a Protein Coding gene. Diseases associated with ARL10 include Martsolf Syndrome. Gene Ontology (GO) annotations related to this gene include GTP binding. An important paralog of this gene is ARL9.
Molecular Mass : 27.3 kDa
AA Sequence : MAPRPLGPLVLALGGAAAVLGSVLFILWKTYFGRGRERRWDRGEAWWGAEAARLPEWDEWDPEDEEDEEPALEELEQREVLVLGLDGAGKSTFLRVLSGKPPLEGHIPTWGFNSVRLPTKDFEVDLLEIGGSQNLRFYWKEFVSEVDVLVFVVDSADRLRLPWARQELHKLLDKDPDLPVVVVANKQDLSEAMSMGELQRELGLQAIDNQREVFLLAASIAPAGPTFEEPGTVHIWKLLLELLSTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name ARL10 ADP-ribosylation factor-like 10 [ Homo sapiens (human) ]
Official Symbol ARL10
Synonyms ARL10; ADP-ribosylation factor-like 10; ADP ribosylation factor like 10A, ARL10A; ADP-ribosylation factor-like protein 10; ADP-ribosylation factor-like 10A; ADP-ribosylation factor-like membrane-associated protein; ARL10A; FLJ39249;
Gene ID 285598
mRNA Refseq NM_173664
Protein Refseq NP_775935
UniProt ID Q8N8L6

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ARL10 Products

Required fields are marked with *

My Review for All ARL10 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon