Recombinant Human ARL10C protein, GST-tagged
| Cat.No. : | ARL10C-803H | 
| Product Overview : | Human ARL10C full-length ORF ( AAH13131, 1 a.a. - 186 a.a.) recombinant protein with GST-tag at N-terminal. | 
- Specification
 - Gene Information
 - Related Products
 - Download
 
| Species : | Human | 
| Source : | Wheat Germ | 
| Tag : | GST | 
| Description : | ARL8B (ADP Ribosylation Factor Like GTPase 8B) is a Protein Coding gene. GO annotations related to this gene include GTP binding and signal transducer activity. An important paralog of this gene is ARL8A. | 
| Molecular Mass : | 46.2 kDa | 
| AA Sequence : | MLALISRLLDWFRSLFWKEEMELTLVGLQYSGKTTFVNVIASGQFSEDMIPTVGFNMRKVTKGNVTIKIWDIGGQPRFRSMWERYCRGVNAIVYMIDAADREKIEASRNELHNLLDKPQLQGIPVLVLGNKRDLPNALDEKQLIEKMNLSAIQDREICCYSISCKEKDNIDITLQWLIQHSKSRRS | 
| Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array | 
| Notes : | Best use within three months from the date of receipt of this protein. | 
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. | 
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. | 
| Gene Name | ARL8B ADP-ribosylation factor-like 8B [ Homo sapiens ] | 
| Official Symbol | ARL8B | 
| Synonyms | ARL8B; ADP-ribosylation factor-like 8B; ADP ribosylation factor like 10C , ARL10C; ADP-ribosylation factor-like protein 8B; FLJ10702; Gie1; ADP-ribosylation factor-like 10C; ADP-ribosylation factor-like protein 10C; novel small G protein indispensable for equal chromosome segregation 1; ARL10C; | 
| Gene ID | 55207 | 
| mRNA Refseq | NM_018184 | 
| Protein Refseq | NP_060654 | 
| UniProt ID | Q9NVJ2 | 
| ◆ Recombinant Proteins | ||
| ARL8B-731M | Recombinant Mouse ARL8B Protein, His (Fc)-Avi-tagged | +Inquiry | 
| ARL8B-444R | Recombinant Rat ARL8B Protein, His (Fc)-Avi-tagged | +Inquiry | 
| ARL8B-788R | Recombinant Rat ARL8B Protein | +Inquiry | 
| ARL8B-301538H | Recombinant Human ARL8B protein, GST-tagged | +Inquiry | 
| ARL8B-1232HF | Recombinant Full Length Human ARL8B Protein, GST-tagged | +Inquiry | 
| ◆ Cell & Tissue Lysates | ||
| ARL8B-8704HCL | Recombinant Human ARL8B 293 Cell Lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
 - Q&As (0)
 
Ask a Question for All ARL8B Products
Required fields are marked with *
My Review for All ARL8B Products
Required fields are marked with *
  
        
    
      
            