Recombinant Human ARL10C protein, GST-tagged
Cat.No. : | ARL10C-803H |
Product Overview : | Human ARL10C full-length ORF ( AAH13131, 1 a.a. - 186 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | ARL8B (ADP Ribosylation Factor Like GTPase 8B) is a Protein Coding gene. GO annotations related to this gene include GTP binding and signal transducer activity. An important paralog of this gene is ARL8A. |
Molecular Mass : | 46.2 kDa |
AA Sequence : | MLALISRLLDWFRSLFWKEEMELTLVGLQYSGKTTFVNVIASGQFSEDMIPTVGFNMRKVTKGNVTIKIWDIGGQPRFRSMWERYCRGVNAIVYMIDAADREKIEASRNELHNLLDKPQLQGIPVLVLGNKRDLPNALDEKQLIEKMNLSAIQDREICCYSISCKEKDNIDITLQWLIQHSKSRRS |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ARL8B ADP-ribosylation factor-like 8B [ Homo sapiens ] |
Official Symbol | ARL8B |
Synonyms | ARL8B; ADP-ribosylation factor-like 8B; ADP ribosylation factor like 10C , ARL10C; ADP-ribosylation factor-like protein 8B; FLJ10702; Gie1; ADP-ribosylation factor-like 10C; ADP-ribosylation factor-like protein 10C; novel small G protein indispensable for equal chromosome segregation 1; ARL10C; |
Gene ID | 55207 |
mRNA Refseq | NM_018184 |
Protein Refseq | NP_060654 |
UniProt ID | Q9NVJ2 |
◆ Recombinant Proteins | ||
ARL8B-731M | Recombinant Mouse ARL8B Protein, His (Fc)-Avi-tagged | +Inquiry |
ARL8B-444R | Recombinant Rat ARL8B Protein, His (Fc)-Avi-tagged | +Inquiry |
ARL8B-788R | Recombinant Rat ARL8B Protein | +Inquiry |
ARL8B-301538H | Recombinant Human ARL8B protein, GST-tagged | +Inquiry |
ARL8B-1232HF | Recombinant Full Length Human ARL8B Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ARL8B-8704HCL | Recombinant Human ARL8B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ARL8B Products
Required fields are marked with *
My Review for All ARL8B Products
Required fields are marked with *