Recombinant Human ARL8B protein, GST-tagged
Cat.No. : | ARL8B-301538H |
Product Overview : | Recombinant Human ARL8B protein(1-186 aa), fused with N-terminal GST tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-186 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. |
AASequence : | MLALISRLLDWFRSLFWKEEMELTLVGLQYSGKTTFVNVIASGQFSEDMIPTVGFNMRKVTKGNVTIKIWDIGGQPRFRSMWERYCRGVNAIVYMIDAADREKIEASRNELHNLLDKPQLQGIPVLVLGNKRDLPNALDEKQLIEKMNLSAIQDREICCYSISCKEKDNIDITLQWLIQHSKSRRS |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
Gene Name | ARL8B ADP-ribosylation factor-like 8B [ Homo sapiens ] |
Official Symbol | ARL8B |
Synonyms | ARL8B; ADP-ribosylation factor-like 8B; ADP ribosylation factor like 10C , ARL10C; ADP-ribosylation factor-like protein 8B; FLJ10702; Gie1; ADP-ribosylation factor-like 10C; ADP-ribosylation factor-like protein 10C; novel small G protein indispensable for equal chromosome segregation 1; ARL10C; |
Gene ID | 55207 |
mRNA Refseq | NM_018184 |
Protein Refseq | NP_060654 |
UniProt ID | Q9NVJ2 |
◆ Recombinant Proteins | ||
Arl8b-1712M | Recombinant Mouse Arl8b Protein, Myc/DDK-tagged | +Inquiry |
ARL8B-1232HF | Recombinant Full Length Human ARL8B Protein, GST-tagged | +Inquiry |
ARL8B-788R | Recombinant Rat ARL8B Protein | +Inquiry |
ARL8B-731M | Recombinant Mouse ARL8B Protein, His (Fc)-Avi-tagged | +Inquiry |
ARL8B-1943M | Recombinant Mouse ARL8B Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
ARL8B-8704HCL | Recombinant Human ARL8B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ARL8B Products
Required fields are marked with *
My Review for All ARL8B Products
Required fields are marked with *