Recombinant Human ARL13B protein, GST-tagged

Cat.No. : ARL13B-805H
Product Overview : Human ARL13B partial ORF ( NP_878899.1, 329 a.a. - 428 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a member of the ADP-ribosylation factor-like family. The encoded protein is a small GTPase that contains both N-terminal and C-terminal guanine nucleotide-binding motifs. This protein is localized in the cilia and plays a role in cilia formation and in maintenance of cilia. Mutations in this gene are the cause of Joubert syndrome 8. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Mar 2010]
Molecular Mass : 36.74 kDa
AA Sequence : KNEDETDRPSLESANGKKKTKKLRMKRNHRVEPLNIDDCAPESPTPPPPPPPVGWGTPKVTRLPKLEPLGETHHNDFYRKPLPPLAVPQRPNSDAHDVIS
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ARL13B ADP-ribosylation factor-like 13B [ Homo sapiens ]
Official Symbol ARL13B
Synonyms ARL13B; ADP-ribosylation factor-like 13B; ADP ribosylation factor like 2 like 1 , ARL2L1; ADP-ribosylation factor-like protein 13B; DKFZp761H079; JBTS8; ARL2-like protein 1; ADP-ribosylation factor-like 2-like 1; ARL2L1; MGC120611; MGC120612; DKFZp686E2075; DKFZp686L2472; DKFZp686M2074;
Gene ID 200894
mRNA Refseq NM_001174150
Protein Refseq NP_001167621
MIM 608922
UniProt ID Q3SXY8

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ARL13B Products

Required fields are marked with *

My Review for All ARL13B Products

Required fields are marked with *

0

Inquiry Basket

cartIcon