Recombinant Human ARL14 Protein, GST-tagged
| Cat.No. : | ARL14-4276H |
| Product Overview : | Human FLJ22595 full-length ORF ( AAH34354, 1 a.a. - 192 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | ARL14 (ADP Ribosylation Factor Like GTPase 14) is a Protein Coding gene. GO annotations related to this gene include GTP binding and signal transducer activity. An important paralog of this gene is ARL11. |
| Molecular Mass : | 46.86 kDa |
| AA Sequence : | MGSLGSKNPQTKQAQVLLLGLDSAGKSTLLYKLKLAKDITTIPTIGFNVEMIELERNFSLTVWDVGGQEKMRTVWGCYCENTDGLVYVVDSTDKQRLEESQRQFEHILKNEHIKNVPVVLLANKQDMPGALTAEDITRMFKVKKLCSDRNWYVQPCCALTGEGLAQGFRKLTGFVKSHMKSRGDTLAFFKQN |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | ARL14 ADP-ribosylation factor-like 14 [ Homo sapiens ] |
| Official Symbol | ARL14 |
| Synonyms | ARL14; ADP-ribosylation factor-like 14; ADP ribosylation factor 7, ARF7; ADP-ribosylation factor-like protein 14; FLJ22595; ADP-ribosylation factor 7; ARF7; |
| Gene ID | 80117 |
| mRNA Refseq | NM_025047 |
| Protein Refseq | NP_079323 |
| MIM | 614439 |
| UniProt ID | Q8N4G2 |
| ◆ Recombinant Proteins | ||
| ARL14-4933HF | Recombinant Full Length Human ARL14 Protein, GST-tagged | +Inquiry |
| ARL14-27187TH | Recombinant Human ARL14, His-tagged | +Inquiry |
| ARL14-4276H | Recombinant Human ARL14 Protein, GST-tagged | +Inquiry |
| ARL14-2489H | Recombinant Human ADP-Ribosylation Factor-Like 14, His-tagged | +Inquiry |
| ARL14-5795Z | Recombinant Zebrafish ARL14 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ARL14-8719HCL | Recombinant Human ARL14 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ARL14 Products
Required fields are marked with *
My Review for All ARL14 Products
Required fields are marked with *
