Recombinant Human ARL2 protein, GST-tagged
| Cat.No. : | ARL2-808H |
| Product Overview : | Human ARL2 full-length ORF ( AAH02530, 1 a.a. - 184 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | ARL5B (ARL8) belongs to a family of proteins that are structurally similar to ADP-ribosylation factors (ARFs; see MIM 103180). ARLs and ARFs are part of the RAS superfamily of regulatory GTPases.[supplied by OMIM, Nov 2010] |
| Molecular Mass : | 45.98 kDa |
| AA Sequence : | MGLLTILKKMKQKERELRLLMLGLDNAGKTTILKKFNGEDIDTISPTLGFNIKTLEHRGFKLNIWDVGGQKSLRSYWRNYFESTDGLIWVVDSADRQRMQDCQRELQSLLVEERLAGATLLIFANKQDLPGALSSNAIREVLELDSIRSHHWCIQGCSAVTGENLLPGIDWLLDDISSRIFTAD |
| Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | ARL2 ADP-ribosylation factor-like 2 [ Homo sapiens ] |
| Official Symbol | ARL2 |
| Synonyms | ARL2; ADP-ribosylation factor-like 2; ADP-ribosylation factor-like protein 2; ARFL2; |
| Gene ID | 402 |
| mRNA Refseq | NM_001199745 |
| Protein Refseq | NP_001186674 |
| MIM | 601175 |
| UniProt ID | P36404 |
| ◆ Recombinant Proteins | ||
| ARL2-9854H | Recombinant Human ARL2, GST-tagged | +Inquiry |
| ARL2-3392H | Recombinant Human ADP-Ribosylation Factor-Like 2, His-tagged | +Inquiry |
| ARL2-5159H | Recombinant Human ARL2 protein, GST-tagged | +Inquiry |
| ARL2-436R | Recombinant Rat ARL2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ARL2-1928M | Recombinant Mouse ARL2 Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ARL2-8716HCL | Recombinant Human ARL2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ARL2 Products
Required fields are marked with *
My Review for All ARL2 Products
Required fields are marked with *
