Recombinant Human ARL2 protein, GST-tagged

Cat.No. : ARL2-808H
Product Overview : Human ARL2 full-length ORF ( AAH02530, 1 a.a. - 184 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : ARL5B (ARL8) belongs to a family of proteins that are structurally similar to ADP-ribosylation factors (ARFs; see MIM 103180). ARLs and ARFs are part of the RAS superfamily of regulatory GTPases.[supplied by OMIM, Nov 2010]
Molecular Mass : 45.98 kDa
AA Sequence : MGLLTILKKMKQKERELRLLMLGLDNAGKTTILKKFNGEDIDTISPTLGFNIKTLEHRGFKLNIWDVGGQKSLRSYWRNYFESTDGLIWVVDSADRQRMQDCQRELQSLLVEERLAGATLLIFANKQDLPGALSSNAIREVLELDSIRSHHWCIQGCSAVTGENLLPGIDWLLDDISSRIFTAD
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ARL2 ADP-ribosylation factor-like 2 [ Homo sapiens ]
Official Symbol ARL2
Synonyms ARL2; ADP-ribosylation factor-like 2; ADP-ribosylation factor-like protein 2; ARFL2;
Gene ID 402
mRNA Refseq NM_001199745
Protein Refseq NP_001186674
MIM 601175
UniProt ID P36404

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ARL2 Products

Required fields are marked with *

My Review for All ARL2 Products

Required fields are marked with *

0
cart-icon
0
compare icon