Recombinant Human ARL2BP protein, GST-tagged
| Cat.No. : | ARL2BP-809H |
| Product Overview : | Human ARL2BP full-length ORF ( AAH03087, 1 a.a. - 163 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | ADP-ribosylation factor (ARF)-like proteins (ARLs) comprise a functionally distinct group of the ARF family of RAS-related GTPases. The protein encoded by this gene binds to ARL2.GTP with high affinity but does not interact with ARL2.GDP, activated ARF, or RHO proteins. The lack of detectable membrane association of this protein or ARL2 upon activation of ARL2 is suggestive of actions distinct from those of the ARFs. This protein is considered to be the first ARL2-specific effector identified, due to its interaction with ARL2.GTP but lack of ARL2 GTPase-activating protein activity. [provided by RefSeq, Jul 2008] |
| Molecular Mass : | 43.67 kDa |
| AA Sequence : | MDALEGESFALSFSSASDAEFDAVVGYLEDIIMDDEFQLLQRNFMDKYYLEFEDTEENKLIYTPIFNEYISLVEKYIEEQLLQRIPEFNMAAFTTTLQHHKDEVAGDIFDMLLTFTDFLAFKEMFLDYRAEKEGRGLDLSSGLVVTSLCKSSSLPASQNNLRH |
| Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | ARL2BP ADP-ribosylation factor-like 2 binding protein [ Homo sapiens ] |
| Official Symbol | ARL2BP |
| Synonyms | ARL2BP; ADP-ribosylation factor-like 2 binding protein; ADP-ribosylation factor-like protein 2-binding protein; BART; BART1; binder of Arl2; binder of Arl Two; binder of ARF2 protein 1; ARF-like 2-binding protein; Arf-like 2 binding protein BART1; |
| Gene ID | 23568 |
| mRNA Refseq | NM_012106 |
| Protein Refseq | NP_036238 |
| UniProt ID | Q9Y2Y0 |
| ◆ Recombinant Proteins | ||
| ARL2BP-453H | Recombinant Human ARL2BP, His tagged | +Inquiry |
| ARL2BP-1929M | Recombinant Mouse ARL2BP Protein | +Inquiry |
| ARL2BP-11234Z | Recombinant Zebrafish ARL2BP | +Inquiry |
| ARL2BP-781R | Recombinant Rat ARL2BP Protein | +Inquiry |
| ARL2BP-311C | Recombinant Cynomolgus ARL2BP Protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ARL2BP-8715HCL | Recombinant Human ARL2BP 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ARL2BP Products
Required fields are marked with *
My Review for All ARL2BP Products
Required fields are marked with *
