Recombinant Human ARL2BP protein, GST-tagged

Cat.No. : ARL2BP-809H
Product Overview : Human ARL2BP full-length ORF ( AAH03087, 1 a.a. - 163 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : ADP-ribosylation factor (ARF)-like proteins (ARLs) comprise a functionally distinct group of the ARF family of RAS-related GTPases. The protein encoded by this gene binds to ARL2.GTP with high affinity but does not interact with ARL2.GDP, activated ARF, or RHO proteins. The lack of detectable membrane association of this protein or ARL2 upon activation of ARL2 is suggestive of actions distinct from those of the ARFs. This protein is considered to be the first ARL2-specific effector identified, due to its interaction with ARL2.GTP but lack of ARL2 GTPase-activating protein activity. [provided by RefSeq, Jul 2008]
Molecular Mass : 43.67 kDa
AA Sequence : MDALEGESFALSFSSASDAEFDAVVGYLEDIIMDDEFQLLQRNFMDKYYLEFEDTEENKLIYTPIFNEYISLVEKYIEEQLLQRIPEFNMAAFTTTLQHHKDEVAGDIFDMLLTFTDFLAFKEMFLDYRAEKEGRGLDLSSGLVVTSLCKSSSLPASQNNLRH
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ARL2BP ADP-ribosylation factor-like 2 binding protein [ Homo sapiens ]
Official Symbol ARL2BP
Synonyms ARL2BP; ADP-ribosylation factor-like 2 binding protein; ADP-ribosylation factor-like protein 2-binding protein; BART; BART1; binder of Arl2; binder of Arl Two; binder of ARF2 protein 1; ARF-like 2-binding protein; Arf-like 2 binding protein BART1;
Gene ID 23568
mRNA Refseq NM_012106
Protein Refseq NP_036238
UniProt ID Q9Y2Y0

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ARL2BP Products

Required fields are marked with *

My Review for All ARL2BP Products

Required fields are marked with *

0
cart-icon